GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-01-24 13:24:31, GGRNA : RefSeq release 209 (Nov, 2021)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX18 (LOC107276211), mRNA. (1267 bp)
db_xref="GeneID:107276211" CDS 331..1119 /gene="LOC107276211" /codon_start=1 /product="homeobox-leucine zipper protein HOX18" /protein_id="XP_015643687.1" /db_xref="GeneID:107276211" /translation="MYSSSSMEGEDLGSWLGLGIGGGGYAYGGDDCRRSPSSPSPVQMLFSQHVKEEITRGYDHGRDEEQASGSKIMKGERGARLRVMRSIRNSGGDGSRSRVLSLGDDGGDGGSTRKKLQLTKEQSTLLEDSFRVHNILSHAQKHELARQLKLKPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTEENKQLKHELMELRRLASPGSQLYVQFPRMVNVCPSCEKVTVMETGKSSSSYSS" misc_feature 703..852 /gene="LOC107276211" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 856..>957 /gene="...
XM_015788201.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX6-like (LOC4347647), mRNA. (1560 bp)
introns" /db_xref="GeneID:4347647" CDS 451..1200 /gene="LOC4347647" /codon_start=1 /product="homeobox-leucine zipper protein HOX6" /protein_id="XP_015612316.1" /db_xref="GeneID:4347647" /translation="MDGEEDSEWMMMDVGGKGGKAADRKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYSALRDDYDALLCSYESLKKEKLALIKQLEKLAEMLQEPRGKYGDNAGDDARSGGVAGMKKEEFVGAGGAATLYSSAEGGGAKLMPHFGSDDVDAGLFLRPSSQHHPPPPHAGAGFTSSEPAADHQSFNFHSSWPSSTEQTCSSTPWWEFESE" misc_feature 538..699 /gene="LOC4347647" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 703..831 /gene="LOC4347647" /...
XM_015756830.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX22 (LOC4336542), mRNA. (1225 bp)
db_xref="GeneID:4336542" CDS 22..852 /gene="LOC4336542" /codon_start=1 /product="homeobox-leucine zipper protein HOX22" /protein_id="XP_015634133.1" /db_xref="GeneID:4336542" /translation="MNGRTQLASWARIAMDRGDHHHLQQQHQFLMPPPAPVVPPQLCMPAMMADEQYMDLGGGGAAAAPGRGGAGERKRRFTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLREREERSGNGGAATTAASSSSCNGSGSEEVKRNAAAGCLDLEPPESCVLGGATCATPADVSVESDQCDDQLDYDEGLFPESFCATPELWEPWPLVEWNAVA" misc_feature 238..402 /gene="LOC4336542" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature...
XM_015778647.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX4-like (LOC4347333), mRNA. (1593 bp)
db_xref="GeneID:4347333" CDS 398..1231 /gene="LOC4347333" /codon_start=1 /product="homeobox-leucine zipper protein HOX4" /protein_id="XP_015612509.1" /db_xref="GeneID:4347333" /translation="MKRPGGASPSLVTMANSSDDGYGGVGMEAEGDVEEEMMACGGGGEKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDSLRLDHDALRRDKDALLAEIKELKAKLGDEEAAASFTSVKEEPAASDGPPAAGFGSSDSDSSAVLNDVDAAGAAPAATDALAPEACTFLGAPPAAGAGAGSHEEVFFHGNFLKVEEDETGFLDDDEPCGGFFADDQPPPLSSWWAEPTEHWN" misc_feature 548..709 /gene="LOC4347333" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 713..838 /...
XM_015757023.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX2-like (LOC4340070), mRNA. (1527 bp)
CDS 188..1114 /gene="LOC4340070" /codon_start=1 /product="homeobox-leucine zipper protein HOX2" /protein_id="XP_015641839.1" /db_xref="GeneID:4340070" /translation="MMDLGLSLGLGLASQGSLTSSTTTTSSPGAGSSSPWAAALNSIVGDVRRDQAAAHAAAAVGVGVGGEEMYQGRASTSPDSAAALSSASGKRERELERSGSGVDDDDGADGAGGRKKLRLSKDQAAVLEECFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCERLADENKRLEKELADLRALKAAPSPASASAMQPSSSAAATLTMCPSCRRVATAGAPHQPNHQQCHPKSNTTISSSSTAAAAVAVAGGNVLPSHCQFFPDRTSQSTWNAAAPLVTRELF" misc_feature 539..691 /gene="LOC4340070" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature...
XM_015786353.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX8-like (LOC4348492), mRNA. (1411 bp)
GeneID:4348492" CDS 221..1138 /gene="LOC4348492" /codon_start=1 /product="homeobox-leucine zipper protein HOX8" /protein_id="XP_015613231.1" /db_xref="GeneID:4348492" /translation="MKRPSCRGSSMAIIHDTSDQQEDNMRSYMDGGGAAAYVEDDDLGEKKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQIERDFAALRSRHDALRLECDALRRDKDALAAEIADLRDRVDGQMSVKLEAVAADEHQLAYNSKVVDGSTDSDSSAVFNEEASPYSGAAIDHHHHQTPASYDTAGFTSFFAPSTTLTSSLSFPSMFHASSHFDGHQELLVGGGGAGAVADADLGGAGFFAGDEHAGGLSWYGAEGW" misc_feature 413..574 /gene="LOC4348492" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 578..703 /...
XM_015757745.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX25 (LOC9266289), mRNA. (1705 bp)
gene="LOC9266289" /codon_start=1 /product="homeobox-leucine zipper protein HOX25" /protein_id="XP_015610704.1" /db_xref="GeneID:9266289" /translation="MCSMDDYSGRLVFSSAGAAPPCSAAGAGGGQMLLFGGHGGFVGGSPVMEEAELKRPFLTTTHDELELQMEDLVDELYGVDEQGSSSAAARKRRLTAEQVRALERSFEEEKRKLEPERKSELARRLGIAPRQVAVWFQNRRARWKTKQLELDFDRLRAAHDELLAGRTALAADNESLRSQVILLTEKLQANGKSPSPSPAPAEQTAVPAAPESAKSFQLEEGRRLYDAAGSTTTTNVAMPAARVAAARAASNDSPESYFAGARSPPSSSEDDCGGAGSDDDYPSSSVLLPVDATLVGDAFEHAVAATVAADEEAPLNSWEWFWN" misc_feature 750..914 /gene="LOC9266289" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_...
XM_015755218.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX13-like (LOC4331890), transcript variant X3, mRNA. (1411 bp)
CDS 217..1062 /gene="LOC4331890" /codon_start=1 /product="homeobox-leucine zipper protein HOX13 isoform X2" /protein_id="XP_015628286.1" /db_xref="GeneID:4331890" /translation="MEQKDEAEMEEVDVDEDMAGGHAAQSPSPSCGLGEKKRRLALEQVRALERSFDTDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFAALRARHDALRADCDALRRDKDALAAEIRELREKLPTKPADTAASVKVEAGNDAAAGAAAATVCKDGSSDDSDSSVVFNDEASPYSGAAFIGFGPSFLVDDASAATVGCSSSLPALESKWHGPYSDDSCKGGVYGFTEEWLAACSGEMAGNDAAGFFSDEHASNLNFGWCASGNEGWE" misc_feature 361..501 /gene="LOC4331890" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 505..633 /gene="...
XM_015772800.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX13-like (LOC4331890), transcript variant X2, mRNA. (1703 bp)
CDS 509..1354 /gene="LOC4331890" /codon_start=1 /product="homeobox-leucine zipper protein HOX13 isoform X2" /protein_id="XP_015628285.1" /db_xref="GeneID:4331890" /translation="MEQKDEAEMEEVDVDEDMAGGHAAQSPSPSCGLGEKKRRLALEQVRALERSFDTDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFAALRARHDALRADCDALRRDKDALAAEIRELREKLPTKPADTAASVKVEAGNDAAAGAAAATVCKDGSSDDSDSSVVFNDEASPYSGAAFIGFGPSFLVDDASAATVGCSSSLPALESKWHGPYSDDSCKGGVYGFTEEWLAACSGEMAGNDAAGFFSDEHASNLNFGWCASGNEGWE" misc_feature 653..793 /gene="LOC4331890" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 797..925 /gene="...
XM_015772799.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX5-like (LOC4345576), mRNA. (1895 bp)
gene="LOC4345576" /codon_start=1 /product="homeobox-leucine zipper protein HOX5" /protein_id="XP_015650258.1" /db_xref="GeneID:4345576" /translation="MDPGRVVFDSGVARRACPGGAQMLLFGGGGSANSGGFFRGVPAAVLGMDESRSSSSAAGAGAKRPFFTTHEELLEEEYYDEQAPEKKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLEHDFDRLKAAYDALAADHHALLSDNDRLRAQVISLTEKLQDKETSPSSATITTAAQEVDQPDEHTEAASTTGFATVDGALAAPPPGHQQPPHKDDLVSSGGTNDDGDGGAAVVVFDVTEGANDRLSCESAYFADAAEAYERDCAGHYALSSEEEDGGAVSDEGCSFDLPDMFGAAGVVHHDAADDEEAQLGSWTAWFWS" misc_feature 788..949 /gene="LOC4345576" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="...
XM_015794772.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX13-like (LOC4331890), transcript variant X1, mRNA. (1584 bp)
CDS 300..1235 /gene="LOC4331890" /codon_start=1 /product="homeobox-leucine zipper protein HOX13 isoform X1" /protein_id="XP_015628283.1" /db_xref="GeneID:4331890" /translation="MKRPTSSSRKSKKQGEDLAFSEEGSLPAVTMEQKDEAEMEEVDVDEDMAGGHAAQSPSPSCGLGEKKRRLALEQVRALERSFDTDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFAALRARHDALRADCDALRRDKDALAAEIRELREKLPTKPADTAASVKVEAGNDAAAGAAAATVCKDGSSDDSDSSVVFNDEASPYSGAAFIGFGPSFLVDDASAATVGCSSSLPALESKWHGPYSDDSCKGGVYGFTEEWLAACSGEMAGNDAAGFFSDEHASNLNFGWCASGNEGWE" misc_feature 534..674 /gene="LOC4331890" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001"...
XM_015772797.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX23-like (LOC4348578), mRNA. (1756 bp)
gene="LOC4348578" /codon_start=1 /product="homeobox-leucine zipper protein HOX23-like" /protein_id="XP_015613423.1" /db_xref="GeneID:4348578" /translation="MRPAMASNGAAAGAMAPFFPPNFLLQMQQPLPLHHQHLQDHAHGGHGGHHLLSLSPFLPDLAMDAPPPPMYEASGGDAASEDEEDGCEKKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDFDALRRQLDAARAENDALLSLNSKLHAEIVALKGGAAAAGGGGSSCRQEAASELINLNVKETEASCSNRSENSSEINLDISRPAANESPVNRGIPFYASIGRGGAGGVDIDQLLLRGGHSPSPAAVTTPPPPKMELGITGNGGGADAAAAGAGSFGGLLCGAVDEQPPFWPWADGHHHFH" misc_feature 494..655 /gene="LOC4348578" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD...
XM_015757937.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX21-like (LOC4331774), mRNA. (1836 bp)
gene="LOC4331774" /codon_start=1 /product="homeobox-leucine zipper protein HOX21" /protein_id="XP_015629266.1" /db_xref="GeneID:4331774" /translation="MASNGMASSPSSFFPPNFLLHMAQQQAAPPHDPQEHHHHHHHGHHGHHHEHHHHLGHPHNPFLPSSAQCPSLQEFRGMAPMLGKRPMSYGDDEVNGGGEDELSDDGSQAGEKKRRLNVEQVRTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALKRQLDAVKAENDALLNHNKKLQAEIVALKGREAASELINLNKETEASCSNRSENSSEINLDISRTPPPDAAALDTAPTAHHHHHMIPFYTSIARPASGGGVDIDQLLHSSSGGAGGPKMEHHGGGGNVQAASVDTASFGNLLCGVDEPPPFWPWPDHQHFH" misc_feature 517..678 /gene="LOC4331774" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD...
XM_015773780.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group WUSCHEL-related homeobox 4-like (LOC4337218), mRNA. (1116 bp)
introns" /db_xref="GeneID:4337218" CDS 178..888 /gene="LOC4337218" /codon_start=1 /product="WUSCHEL-related homeobox 4" /protein_id="XP_015635367.1" /db_xref="GeneID:4337218" /translation="MRLHHLHVAYLDHKAPAPPSISPSSIPGSAAFPAFSFKCLRPLAPKISLPEPRKMIAPPDFVVPRARNASKLLNYTVQVPAAGTTRWNPSAEQIKVLEMLYRGGMRTPNSVQIERITEELGKYGRIEGKNVFYWFQNHKARERQKQKRAALLTLSTLDPSLLPATANETKEAPEKKEKDVEDGLASCKRRCKAWGDGAGDGDAVVATEAAGGCTDEVTLELFPLHPQGKA" misc_feature 448..627 /gene="LOC4337218" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN //...
XM_015779881.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX3 (LOC4326566), transcript variant X2, mRNA. (1042 bp)
CDD:238039" misc_feature order(361..363,370..372,490..492,499..504,511..513) /gene="LOC4326566" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 370..522 /gene="LOC4326566" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature 526..657 /gene="LOC4326566" /note="homeobox associated leucin zipper; Region: HALZ; smart00340" /db_xref="CDD:128634" ORIGIN //...
XM_026027438.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX14-like (LOC4343726), mRNA. (1261 bp)
annotated introns" /db_xref="GeneID:4343726" CDS 264..986 /gene="LOC4343726" /codon_start=1 /product="homeobox-leucine zipper protein HOX14" /protein_id="XP_015646179.1" /db_xref="GeneID:4343726" /translation="MDRYGEKMFASYVDASLLAASGEVQGERPRAGARCVEVDGGDPKKRRLSDEQVEMLELSFREERKLETGRKVHLASELGLDPKQVAVWFQNRRARHKSKLLEEEFSKLKHAHDAAILHKCHLENEVLRLKERLVVAEEEVRRLRSAAGSHTASGEGGDIMGLGGSGACVAGSPSSSFSTGTCQPPSFGGGDHLGDDDLVYVPEYGGYADNSVVEWFSLYGLI" misc_feature 447..608 /gene="LOC4343726" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN //...
XM_015790693.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group WUSCHEL-related homeobox 5 (LOC4327390), mRNA. (1537 bp)
CDS 366..1307 /gene="LOC4327390" /codon_start=1 /product="WUSCHEL-related homeobox 5" /protein_id="XP_015644226.1" /db_xref="GeneID:4327390" /translation="MELRAGGFSDPPSPLSPPLSPASLANARWTPTKEQIAVLEGLYRQGLRTPTAEQIQQITARLREHGHIEGKNVFYWFQNHKARQRQKQKQQSFDYFSKLFRRPPPLPVLHRPLARPFPLAMAPTAMATTTTAACNAGGVMFRTPSFMPVATNNASYYPQQQTPLLYPGMEVCPHDKSTAQPPATTTMYLQAPPSSAHLAAAAGRGAAEAEGHGRRGGGAGGRETLQLFPLQPTFVLPDHKPLRAGSACAAVSPTTPSASASFSWESESSDSPSSEAPPFYDFFGVHSGGR" misc_feature 495..659 /gene="LOC4327390" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN //...
XM_015788740.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX24-like (LOC4330155), mRNA. (1336 bp)
LOCUS XM_015768652 1336 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX24-like (LOC4330155), mRNA. ACCESSION XM_015768652 VERSION XM_015768652.1 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group...gene="LOC4330155" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 292..456 /gene="LOC4330155" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order(292..294,301..303,424..426,433..438,445..447) /gene="LOC4330155" /note="...
XM_015768652.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 3 (LOC4331449), mRNA. (1586 bp)
LOCUS XM_015773433 1586 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 3 (LOC4331449), mRNA. ACCESSION XM_015773433 VERSION XM_015773433.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group...gene="LOC4331449" /note="KNOX2 domain; Region: KNOX2; pfam03791" /db_xref="CDD:397731" misc_feature 1112..1231 /gene="LOC4331449" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015773433.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein ROC8-like (LOC4340445), mRNA. (3480 bp)
misc_feature 633..794 /gene="LOC4340445" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1182..1889 /gene="LOC4340445" /note="C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins; Region: START_ArGLABRA2_like; cd08875" /db_xref="CDD:176884" ORIGIN //...
XM_015786612.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group WUSCHEL-related homeobox 1A-like (LOC107275471), mRNA. (1269 bp)
CDS 135..1004 /gene="LOC107275471" /codon_start=1 /product="WUSCHEL-related homeobox 1B" /protein_id="XP_015635371.1" /db_xref="GeneID:107275471" /translation="MDHMQQQQRQQVEEVAGRGGVPVCRPSGTRWTPTTEQIKILRELYYSCGIRSPNSEQIQRIAAMLRQYGRIEGKNVFYWFQNHKARERQKKRLTTLDVTTTTAAAADADASHLAVLSLSPTAAGATAPSFPGFYVGNGGAVQTDQANVVNWDCTAMAAEKTFLQDYMGVSGVGCAAGAAPTPWAMTTTTREPETLPLFPVVFVGGDGAHRHAVHGGFPSNFQRWGSAAATSNTITVQQHLQQHNFYQLHSQDGPAAGTSLELTLSSYYCSCSPYPAGSM" misc_feature 234..416 /gene="LOC107275471" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:333795" misc_feature order...
XM_015779885.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 2 (LOC4328520), transcript variant X2, mRNA. (1547 bp)
LOCUS XM_015770752 1547 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 2 (LOC4328520), transcript variant X2, mRNA. ACCESSION XM_015770752 VERSION XM_015770752.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa...gene="LOC4328520" /note="KNOX2 domain; Region: KNOX2; pfam03791" /db_xref="CDD:397731" misc_feature 898..1017 /gene="LOC4328520" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015770752.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX29-like (LOC4342089), misc_RNA. (4503 bp)
LOCUS XR_003242807 4503 bp RNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX29-like (LOC4342089), misc_RNA. ACCESSION XR_003242807 VERSION XR_003242807.1 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. COMMENT MODEL REFSEQ: This record is predicted by automated...
XR_003242807.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 2 (LOC4328520), transcript variant X1, mRNA. (1529 bp)
LOCUS XM_015770751 1529 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 2 (LOC4328520), transcript variant X1, mRNA. ACCESSION XM_015770751 VERSION XM_015770751.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa...gene="LOC4328520" /note="KNOX2 domain; Region: KNOX2; pfam03791" /db_xref="CDD:397731" misc_feature 869..988 /gene="LOC4328520" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015770751.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein ROC9-like (LOC4325622), mRNA. (2810 bp)
misc_feature 490..648 /gene="LOC4325622" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1012..1707 /gene="LOC4325622" /note="C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins; Region: START_ArGLABRA2_like; cd08875" /db_xref="CDD:176884" ORIGIN //...
XM_015788973.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 4 (LOC4333698), mRNA. (1656 bp)
LOCUS XM_015773346 1656 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 4 (LOC4333698), mRNA. ACCESSION XM_015773346 VERSION XM_015773346.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group...gene="LOC4333698" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:281743" misc_feature 943..1062 /gene="LOC4333698" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN //...
XM_015773346.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein ATH1 (LOC4328784), transcript variant X3, mRNA. (2460 bp)
LOCUS XM_026022754 2460 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein ATH1 (LOC4328784), transcript variant X3, mRNA. ACCESSION XM_026022754 VERSION XM_026022754.1 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group...gene="LOC4328784" /note="Associated with HOX; Region: POX; pfam07526" /db_xref="CDD:400075" misc_feature 1805..1924 /gene="LOC4328784" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_026022754.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 1 (LOC4325788), mRNA. (1654 bp)
LOCUS XM_015778811 1654 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 1 (LOC4325788), mRNA. ACCESSION XM_015778811 VERSION XM_015778811.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group...gene="LOC4325788" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:397729" misc_feature 1006..1125 /gene="LOC4325788" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015778811.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 7 (LOC4333975), mRNA. (1803 bp)
LOCUS XM_015773336 1803 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 7 (LOC4333975), mRNA. ACCESSION XM_015773336 VERSION XM_015773336.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group...gene="LOC4333975" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:397729" misc_feature 1253..1372 /gene="LOC4333975" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015773336.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein ROC4-like (LOC4336705), mRNA. (3079 bp)
misc_feature 452..613 /gene="LOC4336705" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1061..1777 /gene="LOC4336705" /note="C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins; Region: START_ArGLABRA2_like; cd08875" /db_xref="CDD:176884" ORIGIN //...
XM_015781661.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group WUSCHEL-related homeobox 13 (LOC107281632), mRNA. (2700 bp)
LOCUS XM_015790527 2700 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group WUSCHEL-related homeobox 13 (LOC107281632), mRNA. ACCESSION XM_015790527 VERSION XM_015790527.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq; includes ab initio. SOURCE Oryza sativa Japonica Group...gene="LOC107281632" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 325..501 /gene="LOC107281632" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(325..327,334..336,469..471,478..483,490..492) /gene="LOC107281632" /note="...
XM_015790527.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 6 (LOC4333973), mRNA. (2559 bp)
LOCUS XM_015773906 2559 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 6 (LOC4333973), mRNA. ACCESSION XM_015773906 VERSION XM_015773906.1 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group...gene="LOC4333973" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:397729" misc_feature 1908..2027 /gene="LOC4333973" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015773906.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 10 (LOC4337701), mRNA. (1886 bp)
LOCUS XM_015782412 1886 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 10 (LOC4337701), mRNA. ACCESSION XM_015782412 VERSION XM_015782412.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group...gene="LOC4337701" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:397729" misc_feature 1309..1428 /gene="LOC4337701" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015782412.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group WUSCHEL-related homeobox 8-like (LOC4327441), mRNA. (2420 bp)
LOCUS XM_015770969 2420 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group WUSCHEL-related homeobox 8-like (LOC4327441), mRNA. ACCESSION XM_015770969 VERSION XM_015770969.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice)...note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1020..1196 /gene="LOC4327441" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" ORIGIN //...
XM_015770969.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX29-like (LOC9271485), misc_RNA. (4710 bp)
LOCUS XR_001546695 4710 bp RNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX29-like (LOC9271485), misc_RNA. ACCESSION XR_001546695 VERSION XR_001546695.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. COMMENT MODEL REFSEQ: This record is predicted by automated...
XR_001546695.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX29-like (LOC9270284), misc_RNA. (4710 bp)
LOCUS XR_001546603 4710 bp RNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX29-like (LOC9270284), misc_RNA. ACCESSION XR_001546603 VERSION XR_001546603.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. COMMENT MODEL REFSEQ: This record is predicted by automated...
XR_001546603.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein ROC2-like (LOC4337074), transcript variant X3, mRNA. (3040 bp)
misc_feature 492..656 /gene="LOC4337074" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1041..1730 /gene="LOC4337074" /note="C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins; Region: START_ArGLABRA2_like; cd08875" /db_xref="CDD:176884" ORIGIN //...
XM_015780854.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein ROC2-like (LOC4337074), transcript variant X2, mRNA. (3327 bp)
misc_feature 779..943 /gene="LOC4337074" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1328..2017 /gene="LOC4337074" /note="C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins; Region: START_ArGLABRA2_like; cd08875" /db_xref="CDD:176884" ORIGIN //...
XM_015780853.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein ROC1-like (LOC4344832), transcript variant X2, mRNA. (3322 bp)
misc_feature 771..935 /gene="LOC4344832" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1326..2000 /gene="LOC4344832" /note="C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins; Region: START_ArGLABRA2_like; cd08875" /db_xref="CDD:176884" ORIGIN //...
XM_015794537.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein ROC2-like (LOC4337074), transcript variant X1, mRNA. (3418 bp)
misc_feature 870..1034 /gene="LOC4337074" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1419..2108 /gene="LOC4337074" /note="C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins; Region: START_ArGLABRA2_like; cd08875" /db_xref="CDD:176884" ORIGIN //...
XM_015780852.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group putative WUSCHEL-related homeobox 2 (LOC107275686), mRNA. (1178 bp)
CDS 206..1066 /gene="LOC107275686" /codon_start=1 /product="putative WUSCHEL-related homeobox 2" /protein_id="XP_015639083.1" /db_xref="GeneID:107275686" /translation="MAPAVQQQQSSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLVVPPPQLLPPLHPCGGGLIDHANSLLSPTSATTPTSYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV" misc_feature 281..460 /gene="LOC107275686" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order...
XM_015783597.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 8 (LOC4334261), transcript variant X2, mRNA. (1735 bp)
LOCUS XM_026023682 1735 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 8 (LOC4334261), transcript variant X2, mRNA. ACCESSION XM_026023682 VERSION XM_026023682.1 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa...gene="LOC4334261" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:397729" misc_feature 1172..1291 /gene="LOC4334261" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_026023682.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein BEL1 homolog (LOC4339876), mRNA. (2306 bp)
LOCUS XM_015785518 2306 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein BEL1 homolog (LOC4339876), mRNA. ACCESSION XM_015785518 VERSION XM_015785518.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice)...note="domain associated with HOX domains; Region: POX; smart00574" /db_xref="CDD:214728" misc_feature 1454..1573 /gene="LOC4339876" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015785518.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX29-like (LOC107277851), misc_RNA. (4710 bp)
LOCUS XR_001546691 4710 bp RNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX29-like (LOC107277851), misc_RNA. ACCESSION XR_001546691 VERSION XR_001546691.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. COMMENT MODEL REFSEQ: This record is predicted by automated...
XR_001546691.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein ROC3-like (LOC4349488), transcript variant X1, mRNA. (3755 bp)
misc_feature 729..890 /gene="LOC4349488" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1350..2060 /gene="LOC4349488" /note="C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins; Region: START_ArGLABRA2_like; cd08875" /db_xref="CDD:176884" ORIGIN //...
XM_026020584.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein ROC6-like (LOC4347635), mRNA. (3975 bp)
misc_feature 1121..1282 /gene="LOC4347635" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1808..2482 /gene="LOC4347635" /note="C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins; Region: START_ArGLABRA2_like; cd08875" /db_xref="CDD:176884" ORIGIN //...
XM_015757135.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 12 (LOC4342320), mRNA. (1683 bp)
LOCUS XM_015790631 1683 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein knotted-1-like 12 (LOC4342320), mRNA. ACCESSION XM_015790631 VERSION XM_015790631.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group...gene="LOC4342320" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:397729" misc_feature 1095..1214 /gene="LOC4342320" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015790631.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein ATH1 (LOC4328784), transcript variant X2, mRNA. (2699 bp)
LOCUS XM_015769369 2699 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein ATH1 (LOC4328784), transcript variant X2, mRNA. ACCESSION XM_015769369 VERSION XM_015769369.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group...gene="LOC4328784" /note="Associated with HOX; Region: POX; pfam07526" /db_xref="CDD:400075" misc_feature 2044..2163 /gene="LOC4328784" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015769369.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group homeobox protein BEL1 homolog (LOC4331452), mRNA. (2859 bp)
LOCUS XM_015772706 2859 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox protein BEL1 homolog (LOC4331452), mRNA. ACCESSION XM_015772706 VERSION XM_015772706.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice)...gene="LOC4331452" /note="Associated with HOX; Region: POX; pfam07526" /db_xref="CDD:400075" misc_feature 1671..1790 /gene="LOC4331452" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:399131" ORIGIN //...
XM_015772706.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group putative homeobox protein knotted-1-like 5 (LOC107275599), mRNA. (1356 bp)
LOCUS XM_026023926 1356 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group putative homeobox protein knotted-1-like 5 (LOC107275599), mRNA. ACCESSION XM_026023926 VERSION XM_026023926.1 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq; includes ab initio. SOURCE Oryza sativa...gene="LOC107275599" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:309059" misc_feature 856..975 /gene="LOC107275599" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:310480" ORIGIN //...
XM_026023926.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/os/homeobox
lang : en | div : | spe : os | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.091 | 0.091 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Oryza sativa Japonica Group (Japanese rice)?to=0&format=json
0.170 | 0.079 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Oryza sativa Japonica Group (Japanese rice)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.175 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]