GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-01-24 11:38:48, GGRNA : RefSeq release 209 (Nov, 2021)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Rattus norvegicus microfibril associated protein 5 (Mfap5), mRNA. (881 bp)
codon_start=1 /product="microfibrillar-associated protein 5 precursor" /protein_id="NP_001102114.1" /db_xref="GeneID:362429" /db_xref="RGD:1307919" /translation="MLVFGQKALLLVVALSIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTVLADITPSTDDLASAGDKNTTAECRDEKFACTRLYSVHRPVRQCVHQACFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGP" sig_peptide 148..195 /gene="Mfap5" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 157..540 /gene="Mfap5" /note="Microfibril-associated glycoprotein (MAGP); Region: MAGP; pfam05507" /db_xref="CDD:398907" STS 486..688 /gene="Mfap5" /standard_name...
AA_position 129
NM_001108644.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus solute carrier family 25 member 2 (Slc25a2), mRNA. (1197 bp)
mitochondrial ornithine transporter 2" /protein_id="NP_001099622.1" /db_xref="GeneID:291640" /db_xref="RGD:1310667" /translation="MQTFPYMYKGLADCFLKTYNQVGVHGLYRGTSPALLAYVAQGSVLFLCYGFCQQFVRKVARVEQSAELNDFETATAGSLASAFAALVLCPTELVKCRLQTMHEMRVAGKTKHSHNTIWSMVKSIFMKDGPLGFYRGLSTTLAQEIPGYFFYFGGYEISRSFFASGGSKDELGPVPLMLSGSFAGVCLWLIIFPVDCIKSRIQVLSMFGKPAGLIKTFINVVRNEGILALYSGLKATLIRAIPSNAALFVVYEYSRKMMMNVVEEY" misc_feature <108..281 /gene="Slc25a2" /note="Mitochondrial carrier protein; Region: Mito_carr; pfam00153" /db_xref="CDD:278578" misc_feature 306..593 /gene="Slc25a2" /note="Mitochondrial carrier protein...
AA_position 168
NM_001106152.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Ly-49 stimulatory receptor 3 (Ly49s3), mRNA. (1420 bp)
stimulatory receptor 3" /protein_id="NP_714948.1" /db_xref="GeneID:266768" /db_xref="RGD:628683" /translation="MSKQDVPCSTVRFKKSSGLQYQVRPEETQRPREAGWRVPWQLTVIATGILLSLRLVAVAMLVTNIFQYSNENHELQKTHKRQHNSSTMEKDIKLKEEMLRNMSVESVHYNAFLDLINREQNRWYKKTKTVLASPQHTGGCDEMHWFCYGIKCYYFTMDIRIWRECKQTCQNYSLSFLKIDDKDELKFLQDHIIRDNYWIGSSYNNKKKEWAWIDNSPFDLDFVARTLLRKTGYCLYFSMSGLHDDDCGKRYLCICEKGMDKFPAPLCSVKETSHSAV" misc_feature 249..602 /gene="Ly49s3" /note="Ly49-like protein, N-terminal region; Region: Ly49; pfam08391" /db_xref="CDD:285577" misc_feature 561..908 /gene="Ly49s3" /note="C-type lectin-like domain (CTLD) of...
AA_position 182
NM_153726.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus glycosylation dependent cell adhesion molecule 1 (Glycam1), mRNA. (584 bp)
gene="Glycam1" /note="SGP50; glyCAM-1; sulfated 50 kDa glycoprotein; endothelial ligand FOR L-selectin" /codon_start=1 /product="glycosylation-dependent cell adhesion molecule 1 precursor" /protein_id="NP_036926.2" /db_xref="GeneID:25258" /db_xref="RGD:2712" /translation="MKFFTVLLFASLAATSLAAVPGSKDELHLRTQPTDAIPASQFTPSSHISKESTSSKDLSKESSIFNEELVSEDNVGTESTKPQSQEAQDGLRSGSSQQEETTSAATSEGKLTMLSQAVQKELGKVIEGFISGVEDIISGASGTVRP" sig_peptide 22..75 /gene="Glycam1" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 79..459 /gene="Glycam1" /note="Glycosylation-dependent cell adhesion...
AA_position 24
NM_012794.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X19, mRNA. (791 bp)
GeneID:289280" /db_xref="RGD:1308593" CDS 236..532 /gene="Efcab2" /gene_synonym="RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X13" /protein_id="XP_038946479.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature <239..529 /gene="Efcab2" /gene_synonym="RGD1308593" /note="Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]; Region: FRQ1; COG5126" /db_xref="CDD:227455" ORIGIN //...
AA_position 35
Synonym: RGD1308593
XM_039090551.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X18, mRNA. (728 bp)
GeneID:289280" /db_xref="RGD:1308593" CDS 173..469 /gene="Efcab2" /gene_synonym="RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X13" /protein_id="XP_038946478.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature <176..466 /gene="Efcab2" /gene_synonym="RGD1308593" /note="Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]; Region: FRQ1; COG5126" /db_xref="CDD:227455" ORIGIN //...
AA_position 35
Synonym: RGD1308593
XM_039090550.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus glia maturation factor, beta (Gmfb), transcript variant X3, mRNA. (1123 bp)
introns" /db_xref="GeneID:81661" /db_xref="RGD:70910" CDS 789..1097 /gene="Gmfb" /codon_start=1 /product="glia maturation factor beta isoform X3" /protein_id="XP_038949612.1" /db_xref="GeneID:81661" /db_xref="RGD:70910" /translation="MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRPSLCIVINTSTTMAGSPTLCALSSPVLWGANLSSR" misc_feature 813..>989 /gene="Gmfb" /note="Actin depolymerization factor/cofilin- and gelsolin-like domains; Region: ADF_gelsolin; cl15697" /db_xref="CDD:417759" ORIGIN //...
AA_position 58
XM_039093684.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus glia maturation factor, beta (Gmfb), transcript variant X2, mRNA. (2431 bp)
with support for all annotated introns" /db_xref="GeneID:81661" /db_xref="RGD:70910" CDS 1208..1540 /gene="Gmfb" /codon_start=1 /product="glia maturation factor beta isoform X2" /protein_id="XP_038949611.1" /db_xref="GeneID:81661" /db_xref="RGD:70910" /translation="MKIDKDKRLVVLDEELEGVSPDELKDELPERQPRTFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH" misc_feature <1208..1501 /gene="Gmfb" /note="ADF-homology domain of glia maturation factor beta and related proteins; Region: ADF_GMF-beta_like; cd11283" /db_xref="CDD:200439" ORIGIN //...
AA_position 25
XM_039093683.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus trafficking protein particle complex 6B (Trappc6b), transcript variant X1, mRNA. (1115 bp)
CDS 224..589 /gene="Trappc6b" /gene_synonym="RGD1309325" /codon_start=1 /product="trafficking protein particle complex subunit 6B isoform X1" /protein_id="XP_038967906.1" /db_xref="GeneID:299075" /db_xref="RGD:1309325" /translation="MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKANSR" misc_feature 230..>574 /gene="Trappc6b" /gene_synonym="RGD1309325" /note="Trs33 subunit of the TRAPP complex; Region: TRAPPC6A_Trs33; cd14944" /db_xref="CDD:271347" misc_feature order...
AA_position 59
Synonym: RGD1309325
XM_039111978.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus methyltransferase like 14 (Mettl14), mRNA. (2596 bp)
like protein 14; N6-adenosine-methyltransferase subunit METTL14" /codon_start=1 /product="N6-adenosine-methyltransferase non-catalytic subunit" /protein_id="NP_001099940.1" /db_xref="GeneID:295428" /db_xref="RGD:1304822" /translation="MSLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNSKRKCLDEGETDEDKVEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGIAANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYL...
AA_position 61
Synonym: RGD1304822
NM_001106470.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X16, mRNA. (947 bp)
RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X11" /protein_id="XP_038946476.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGQSIQVFP" misc_feature 465..>785 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 116
Synonym: RGD1308593
XM_039090548.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X15, mRNA. (1218 bp)
RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X11" /protein_id="XP_038946475.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGQSIQVFP" misc_feature 464..>784 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 116
Synonym: RGD1308593
XM_039090547.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), mRNA. (2604 bp)
hand calcium-binding domain-containing protein 2-like" /codon_start=1 /product="dynein regulatory complex protein 8" /protein_id="NP_001099447.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature 238..624 /gene="Efcab2" /gene_synonym="RGD1308593" /note="centrin; Provisional; Region: PTZ00183" /db_xref="CDD:185503" misc_feature 442..624 /gene="Efcab2" /gene_synonym="RGD1308593" /note="EF-hand, calcium binding motif; A diverse...
AA_position 90
Synonym: RGD1308593
NM_001105977.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus methyltransferase like 14 (Mettl14), transcript variant X1, mRNA. (2662 bp)
Mettl14" /gene_synonym="RGD1304822" /codon_start=1 /product="N6-adenosine-methyltransferase non-catalytic subunit isoform X1" /protein_id="XP_006233328.1" /db_xref="GeneID:295428" /db_xref="RGD:1304822" /translation="MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNSKRKCLDEGETDEDKVEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGIAANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNS...
AA_position 81
Synonym: RGD1304822
XM_006233266.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus glia maturation factor, beta (Gmfb), mRNA. (1424 bp)
CDS 84..512 /gene="Gmfb" /note="GMF-beta; DNA for thyroid hormone receptor binding site (276bp)" /codon_start=1 /product="glia maturation factor beta" /protein_id="NP_112294.1" /db_xref="GeneID:81661" /db_xref="RGD:70910" /translation="MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH" misc_feature 87..89 /gene="Gmfb" /note="N-acetylserine. /evidence=ECO:0000269|Ref.4; propagated from UniProtKB/Swiss-Prot (Q63228.2); acetylation site" misc_feature 108..473 /gene="Gmfb" /note="ADF-homology domain of...
AA_position 58
NM_031032.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus glia maturation factor, beta (Gmfb), transcript variant X1, mRNA. (2111 bp)
introns" /db_xref="GeneID:81661" /db_xref="RGD:70910" CDS 789..1220 /gene="Gmfb" /codon_start=1 /product="glia maturation factor beta isoform X1" /protein_id="XP_006251876.1" /db_xref="GeneID:81661" /db_xref="RGD:70910" /translation="MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRTFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH" misc_feature 813..1181 /gene="Gmfb" /note="ADF-homology domain of glia maturation factor beta and related proteins; Region: ADF_GMF-beta_like; cd11283" /db_xref="CDD:200439" ORIGIN //...
AA_position 58
XM_006251814.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X14, mRNA. (1177 bp)
RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X10" /protein_id="XP_038946474.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGQSIQVFP" misc_feature 466..>783 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 116
Synonym: RGD1308593
XM_039090546.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X13, mRNA. (1265 bp)
RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X10" /protein_id="XP_038946473.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGQSIQVFP" misc_feature 466..>783 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 116
Synonym: RGD1308593
XM_039090545.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X12, mRNA. (1129 bp)
gene="Efcab2" /gene_synonym="RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X9" /protein_id="XP_038946472.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature 463..867 /gene="Efcab2" /gene_synonym="RGD1308593" /note="Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]; Region: FRQ1; COG5126" /db_xref="CDD:227455" ORIGIN //...
AA_position 90
Synonym: RGD1308593
XM_039090544.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus ring finger protein 122 (Rnf122), transcript variant X2, mRNA. (1835 bp)
RGD:1561238" CDS 424..891 /gene="Rnf122" /codon_start=1 /product="RING finger protein 122 isoform X2" /protein_id="XP_038951022.1" /db_xref="GeneID:502091" /db_xref="RGD:1561238" /translation="MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIAGPTETSQSIGILLDELV" misc_feature 694..834 /gene="Rnf122" /note="RING finger, H2 subclass, found in RING finger proteins RNF24, RNF122, and similar proteins; Region: RING-H2_RNF24_like; cd16469" /db_xref="CDD:319383" misc_feature order...
AA_position 103
XM_039095094.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X11, mRNA. (4619 bp)
RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X8" /protein_id="XP_038946471.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGSNIWIVANELQTDQGVSNDDRWGLFEGNG" misc_feature 467..>784 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 116
Synonym: RGD1308593
XM_039090543.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus B-cell receptor-associated protein 31 (Bcap31), transcript variant X4, mRNA. (1084 bp)
gene_synonym="Bap31" /codon_start=1 /product="B-cell receptor-associated protein 31 isoform X2" /protein_id="XP_038955458.1" /db_xref="GeneID:293852" /db_xref="RGD:1302944" /translation="MEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGTAEDGGKLDVGSPEMKLEENKILKTDLKKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSDKKEE" misc_feature <233..373 /gene="Bcap31" /gene_synonym="Bap31" /note="B-cell receptor-associated protein 31-like; Region: Bap31; cl02219" /db_xref="CDD:413240" misc_feature <392..613 /gene="Bcap31" /gene_synonym="Bap31" /note="Alanyl-tRNA synthetase...
AA_position 103
Synonym: Bap31
XM_039099530.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus trafficking protein particle complex subunit 6B (Trappc6b), mRNA. (1165 bp)
gene_synonym="RGD1309325" /note="trafficking protein particle complex 6B" /codon_start=1 /product="trafficking protein particle complex subunit 6B" /protein_id="NP_001100203.1" /db_xref="GeneID:299075" /db_xref="RGD:1309325" /translation="MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL" misc_feature 185..646 /gene="Trappc6b" /gene_synonym="RGD1309325" /note="Trs33 subunit of the TRAPP complex; Region: TRAPPC6A_Trs33; cd14944" /db_xref="CDD:271347" misc_feature order...
AA_position 59
Synonym: RGD1309325
NM_001106733.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X10, mRNA. (969 bp)
Efcab2" /gene_synonym="RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X7" /protein_id="XP_038946470.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAWRRVRARNSLSPLSQTLQIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature 282..695 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 96
Synonym: RGD1308593
XM_039090542.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X9, mRNA. (1440 bp)
Efcab2" /gene_synonym="RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X7" /protein_id="XP_038946469.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAWRRVRARNSLSPLSQTLQIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature 753..1166 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 96
Synonym: RGD1308593
XM_039090541.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X8, mRNA. (1911 bp)
Efcab2" /gene_synonym="RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X7" /protein_id="XP_038946468.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAWRRVRARNSLSPLSQTLQIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature 1224..1637 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 96
Synonym: RGD1308593
XM_039090540.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X7, mRNA. (921 bp)
Efcab2" /gene_synonym="RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X7" /protein_id="XP_038946467.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAWRRVRARNSLSPLSQTLQIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature 234..647 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 96
Synonym: RGD1308593
XM_039090539.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LRR binding FLII interacting protein 2 (Lrrfip2), transcript variant 2, mRNA. (1833 bp)
translation="MGTPGSGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRMRELERQQRELDEKSDKQYAENYTRPSSRNSASATTPLSGNSSRRGSGDTSSLIDPDTSLSELRDIYDLKDQIHDVEGRYMQGLKELKESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVIEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMDELKEGLRQRDELIEKHGLVIIPESTPNGDVNHEPVVGAITAVSQEAAQVLESAGEGPLDVRLRKLAEEKDELLSQIRKLKLQLEEERQKCSRNDGMSGDLAGLQNGSDLQFIEMQRDANRQISEYKFKLSKAEQDIATLEQSISRLEGQVLRYKTAAENAEKIEDELKAEKRKLQRELRTAQDKIEEMEMTNSHLAKRLEKMKANRTALLAQQ" misc_feature 537..1445 /gene="Lrrfip2" /note="LRRFIP family; Region: LRRFIP; pfam09738" /db_xref="CDD:401617" misc_feature 1491..>1670 /gene="Lrrfip2" /note="...
AA_position 280
NM_001395739.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X6, mRNA. (1122 bp)
Efcab2" /gene_synonym="RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X6" /protein_id="XP_038946466.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MGSPRRRAPHQDGGGKGPGEYREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature 408..848 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 99
Synonym: RGD1308593
XM_039090538.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X5, mRNA. (1176 bp)
RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X5" /protein_id="XP_038946465.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGQRALFLASLFPKRKWKKCCLLQLILNQTPLITETT" misc_feature 466..>789 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 116
Synonym: RGD1308593
XM_039090537.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus TPD52 like 1 (Tpd52l1), mRNA. (1272 bp)
exon 1..122 /gene="Tpd52l1" /inference="alignment:Splign:2.0.8" CDS 104..595 /gene="Tpd52l1" /note="tumor protein D52-like 1" /codon_start=1 /product="tumor protein D53" /protein_id="NP_001037760.1" /db_xref="GeneID:689256" /db_xref="RGD:1594796" /translation="MEAQAQGLLETEPLQGRDGDAIGSADLSSMLSEEEKDELKAELVQLEEEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSRSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISRKFGDMRYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKV" misc_feature 137..571 /gene="Tpd52l1" /note="Tumour protein D52 family; Region: TPD52; pfam04201" /db_xref="CDD:282107" exon 123..238 /gene="Tpd52l1" /inference="alignment:...
AA_position 36
NM_001044295.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X4, mRNA. (1151 bp)
RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X4" /protein_id="XP_006250381.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature 410..874 /gene="Efcab2" /gene_synonym="RGD1308593" /note="centrin; Provisional; Region: PTZ00183" /db_xref="CDD:185503" misc_feature 455..646 /gene="Efcab2" /gene_synonym="RGD1308593" /note="EF-hand, calcium binding motif; A diverse superfamily...
AA_position 116
Synonym: RGD1308593
XM_006250319.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus microfibril associated protein 5 (Mfap5), transcript variant X1, mRNA. (946 bp)
codon_start=1 /product="microfibrillar-associated protein 5 isoform X1" /protein_id="XP_017448192.1" /db_xref="GeneID:362429" /db_xref="RGD:1307919" /translation="MLVFGQKALLLVVALSIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTVLADITPSTDDLASAGDKNTTAECRDEKFACTRLYSVHRPVRQCVHQACFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGP" misc_feature 258..641 /gene="Mfap5" /note="Microfibril-associated glycoprotein (MAGP); Region: MAGP; pfam05507" /db_xref="CDD:398907" ORIGIN //...
AA_position 129
XM_017592703.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus TPD52 like 1 (Tpd52l1), transcript variant X3, mRNA. (874 bp)
support for all annotated introns" /db_xref="GeneID:689256" /db_xref="RGD:1594796" CDS 218..724 /gene="Tpd52l1" /codon_start=1 /product="tumor protein D53 isoform X3" /protein_id="XP_038947273.1" /db_xref="GeneID:689256" /db_xref="RGD:1594796" /translation="MEAQAQGLLETEPLQGRDGDAIGSADLSSMLSEEEKDELKAELVQLEEEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSRSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISRKFGDMRSHSIGYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKV" misc_feature 251..700 /gene="Tpd52l1" /note="tumor protein D52 family; Region: TPD52; pfam04201" /db_xref="CDD:398052" ORIGIN //...
AA_position 36
XM_039091345.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus stem-loop binding protein-like (LOC100363294), mRNA. (941 bp)
uncharacterized protein LOC100363294" /protein_id="NP_001257345.2" /db_xref="GeneID:100363294" /db_xref="RGD:2323347" /translation="MSLSSRMEMVSVGVTTEPCHARWEVETDEVVLRRRQKQIDYGKCTPGYQSFLQQVPRAQRQPGFHPQTPNKNRRYSRRSWDAQIRQWRRALHTWDPPSQPLHDRQAEGKAAGNFLRPVDTAPLDDLLDNWPQDPESSENWDRGEKEAQFAYLKVPASCPPQLKDELLHH" misc_feature 344..550 /gene="LOC100363294" /gene_synonym="SLBP2" /note="Histone RNA hairpin-binding protein RNA-binding domain; Region: SLBP_RNA_bind; pfam15247" /db_xref="CDD:405844" exon 331..435 /gene="LOC100363294" /gene_synonym="SLBP2" /inference="alignment:Splign:2.1.0" exon 436..588 /gene...
AA_position 163
Synonym: SLBP2
NM_001270416.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LRR binding FLII interacting protein 2 (Lrrfip2), transcript variant 1, mRNA. (1836 bp)
MGTPGSGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRMRELERQQRESSSKDITGTHWSRASTPKRRDMMYDSIKDRSSRVSSLLDEKSDKQYAENYTRPSSRNSASATTPLSGNSSRRGSGDTSSLIDPDTSLSELRESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVIEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMDELKEGLRQRDELIEKHGLVIIPESTPNGDVNHEPVVGAITAVSQEAAQVLESAGEGPLDVRLRKLAEEKDELLSQIRKLKLQLEEERQKCSRNDGMSGDLAGLQNGSDLQFIEMQRDANRQISEYKFKLSKAEQDIATLEQSISRLEGQVLRYKTAAENAEKIEDELKAEKRKLQRELRTAQDKIEEMEMTNSHLAKRLEKMKANRTALLAQQ" misc_feature 390..392 /gene="Lrrfip2" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (Q4V7E8.1);...
AA_position 293
NM_001024761.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ribosomal protein S5 (Rps5), transcript variant 2, mRNA. (666 bp)
product="40S ribosomal protein S5 isoform 2" /protein_id="NP_001264173.1" /db_xref="GeneID:25538" /db_xref="RGD:3601" /translation="MTEWETATPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQGSSNSYAIKKKDELERVAKSNR" misc_feature 150..611 /gene="Rps5" /note="Eukaryota homolog of Ribosomal Protein S7; Region: uS7_Eukaryote; cd14867" /db_xref="CDD:271246" misc_feature order(150..152,237..245,249..260,357..359,369..371) /gene="Rps5" /note="S9 interface [polypeptide binding]; other site" /db_xref="CDD:271246"...
AA_position 160
NM_001277244.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X3, mRNA. (1197 bp)
synonym="RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X3" /protein_id="XP_038946464.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature 471..923 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 113
Synonym: RGD1308593
XM_039090536.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X2, mRNA. (1049 bp)
RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X2" /protein_id="XP_038946463.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MTPLGPKNAGLSSWGVGRRPPRVEGLPPPRPPRAARRVCDGISQATGSAPRWRRKRTRRVQVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature <458..787 /gene="Efcab2" /gene_synonym="RGD1308593" /note="Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms]; Region: FRQ1; COG5126" /db_xref="CDD:227455" ORIGIN //...
AA_position 114
Synonym: RGD1308593
XM_039090535.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus EF-hand calcium binding domain 2 (Efcab2), transcript variant X1, mRNA. (1202 bp)
RGD1308593" /codon_start=1 /product="dynein regulatory complex protein 8 isoform X1" /protein_id="XP_038946462.1" /db_xref="GeneID:289280" /db_xref="RGD:1308593" /translation="MAEEKDPESTEAIVAELHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMTTVLLEKRYRPIAEDVLLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWRLPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMVIDEN" misc_feature 467..928 /gene="Efcab2" /gene_synonym="RGD1308593" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" ORIGIN //...
AA_position 116
Synonym: RGD1308593
XM_039090534.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus FER tyrosine kinase (Fer), transcript variant 1, mRNA. (3387 bp)
translation="MEQSVECPHCEGDLEPDSDSKFCKKCSIPMSPGPSSSEIQRYQERKERLSKFESIRHSIAGIIKSPKSVLGSSTLSDVISVGEKPLAEHDWYHGAIPRIEAQELLKQQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQFVDNLYRFEGTGFSNIPQLIDHHFNTKQVITKKSGVVLLNPIPKDKKWVLNHEDVSLGELLGKGNFGEVYKGTLKDKTPVAVKTCKEDLPQELKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPVYIIMELVPGGDFLSFLRKRKDELKLKQLVRFSLDVAAGMLYLEGKICIHRDLAARNCLVGENNTLKISDFGMSRQEDGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMSAPQNCPEEIFTIMMKCWDYKPENRPKFSDLHKELTAIKKKIT" misc_feature 774..1031 /gene="Fer" /gene_synonym="Fert2; Flk; Flk_retired" /note="Src homology 2 (SH2) domain found in feline...
AA_position 284
Synonym: Fert2; Flk; Flk_retired
NM_001106928.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus ring finger protein 122 (Rnf122), transcript variant X1, mRNA. (4239 bp)
gene="Rnf122" /codon_start=1 /product="RING finger protein 122 isoform X1" /protein_id="XP_038951021.1" /db_xref="GeneID:502091" /db_xref="RGD:1561238" /translation="MVNVERILALFQHQIFLWQDEGRRLLAVEGGPVGPEGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIAGPTETSQSIGILLDELV" misc_feature 3098..3238 /gene="Rnf122" /note="RING finger, H2 subclass, found in RING finger proteins RNF24, RNF122, and similar proteins; Region: RING-H2_RNF24_like; cd16469" /db_xref="CDD:319383" misc_feature order...
AA_position 131
XM_039095093.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus nuclear assembly factor 1 ribonucleoprotein (Naf1), mRNA. (2170 bp)
codon_start=1 /product="H/ACA ribonucleoprotein complex non-core subunit NAF1" /protein_id="NP_001019943.1" /db_xref="GeneID:306387" /db_xref="RGD:1306802" /translation="MEVVEAAAQLQTLKFGGSGPGSAASPPPEERPDAEQAEQAPPAGEQPPPAPSSDAGENPPPPSGPCATAPDAAEPLPELQDSDSSDSDSDSETDSDCGSLPPVLSDGEEDVQVEKENKNFPLKTKDELLLNELPSVEELTVTLPEDIALKPLGKVSSIIEQLVIIESMTNIPPVNEDTVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSEHIESKGIKIKDTMYFAPSMKDFTQYIFTEKLKQDRGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSELNESGEDFGEVHQNWNANSSSEHSKGYHNREFTRGFPRGRYSRGSHGRPPPQQYYNSDPMASQESLGFPPQRQDNPVMPHYPFPPPMFDMHNFPLTVSMGWAAPSMTSHPVLNLPYSLPPPPLSPGESNSSHFGSYY"...
AA_position 139
Synonym: RGD1306802
NM_001024772.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus 60S ribosomal protein L9 pseudogene (LOC103692829), mRNA. (713 bp)
codon_start=1 /product="60S ribosomal protein L9-like" /protein_id="XP_038936008.1" /db_xref="GeneID:103692829" /db_xref="RGD:9187595" /translation="MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQ" misc_feature 40..600 /gene="LOC103692829" /note="Ribosomal protein L6; Region: Ribosomal_L6; cl30086" /db_xref="CDD:421973" ORIGIN //...
AA_position 141
XM_039080080.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus similar to RIKEN cDNA B230219D22 (RGD1566359), mRNA. (4366 bp)
GeneID:498701" /db_xref="RGD:1566359" CDS 199..768 /gene="RGD1566359" /codon_start=1 /product="UPF0461 protein C5orf24 homolog" /protein_id="XP_003751692.1" /db_xref="GeneID:498701" /db_xref="RGD:1566359" /translation="MMHPVAGGNPAFCGPGKPPCLSDDAAMRAADQFDLYSSQQSKYSHTVSHKPMLCQRQDPLNEAHLQPTSGRNTEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHSRVVHGVQETSGEVKPPSE" misc_feature 199..765 /gene="RGD1566359" /note="Family of unknown function (DUF5568); Region: DUF5568; pfam17724" /db_xref="CDD:407600" ORIGIN //...
AA_position 76
XM_003751644.5 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus tRNA splicing endonuclease subunit 2 (Tsen2), mRNA. (1782 bp)
splicing endonuclease subunit Sen2" /protein_id="NP_001014079.1" /db_xref="GeneID:312649" /db_xref="RGD:1309946" /translation="MAEAVFRAPKRKRRVYESYESPLPIPFSQDQSPRKEFRIFQAEMISNNVVVRGTEDMEQLYGKGYFGKGILSRSRPNFTISNPKLAARWKGVQTDMPIITSEKYQHRVEWARDFMRRQGHDESTVQKILTDYTEPLEPPYRERKGESPQHEPLSSKADSSLEGREGKDELSVTTGGAGQSDDLQGLNTHSDCRQEGPGHATLTVASPSSLNGHAIEDPEALSQIPCCSQEALGQQDDLWPEASSQIAGESRAAHEYVLIEEELCDVQEGAAPHDELLKRKRLVCRRNPYRIFEYLQLSLEEAFFLAYALGCLSIYYEKEPLTIVKLWQAFTAVQPTFRTTYMAYHYFRSKGWVPKVGLKYGTDLLLYRKGPPFYHASYSVIIELVDDNFEGSLRRPFSWKSLAALSRVSGNVSKELMLCYLIKPSTMTNEDMETPECMRRIQVQEVILSRWVSSRERSDQDEL" misc_...
AA_position 167
Synonym: RGD1309946
NM_001014057.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus similar to 60S ribosomal protein L9 (RGD1565048), mRNA. (662 bp)
RGD1565048" /codon_start=1 /product="60S ribosomal protein L9-like" /protein_id="XP_038948626.1" /db_xref="GeneID:305275" /db_xref="RGD:1565048" /translation="MKTILSNQTVDIPENVHITLKGHTVKGPRGTLRRDFNHINVELSLLGKKKKRLHVDKWWSNRKELVTVRSICSHVQNMIKGETLGFHYKMRSVYAHFPINVVIQENRSLVEIRNFLGEKYIQRVQMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLNGIYVSEKGTVQQPDE" misc_feature 30..590 /gene="RGD1565048" /note="Ribosomal protein L6; Region: Ribosomal_L6; cl30086" /db_xref="CDD:421973" ORIGIN //...
AA_position 139
XM_039092698.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus transmembrane protein 40 (Tmem40), transcript variant X2, mRNA. (1217 bp)
xref="RGD:1587025" CDS 112..687 /gene="Tmem40" /gene_synonym="RGD1306976" /codon_start=1 /product="transmembrane protein 40 isoform X2" /protein_id="XP_038964274.1" /db_xref="GeneID:680858" /db_xref="RGD:1587025" /translation="MSPGTPGKEMEASGSSSQSPNSSAVHRETEDLNHSSDEDKHSRGPRKHRRKSHRDSSPGADHGELEVLKDELQLYGGAAGEMVLAGESGLRRRGSGSAEGEVEASQLNRLNIKKDDEFFHFVLLCFAIGALLVCYHYYSDWFMSLGVGLLTFASLETIGIYFGLVYRIHSVLQGFIPLLQKFRLPGFRRTN" misc_feature 322..681 /gene="Tmem40" /gene_synonym="RGD1306976" /note="Transmembrane protein 40 family; Region: TMEM40; pfam15817" /db_xref="CDD:374141" ORIGIN //...
AA_position 69
Synonym: RGD1306976
XM_039108346.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus TPD52 like 1 (Tpd52l1), transcript variant X2, mRNA. (1276 bp)
support for all annotated introns" /db_xref="GeneID:689256" /db_xref="RGD:1594796" CDS 214..789 /gene="Tpd52l1" /codon_start=1 /product="tumor protein D53 isoform X2" /protein_id="XP_008756896.1" /db_xref="GeneID:689256" /db_xref="RGD:1594796" /translation="MEAQAQGLLETEPLQGRDGDAIGSADLSSMLSEEEKDELKAELVQLEEEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSRSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISRKFGDMRNSPTFKSFEERVETTVTSLKTKVGGTNHSGGSFEEVLSSTAHASSQNASAGIRQTREEDLQC" misc_feature 247..735 /gene="Tpd52l1" /note="Tumour protein D52 family; Region: TPD52; pfam04201" /db_xref="CDD:282107" ORIGIN //...
AA_position 36
XM_008758674.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ribosomal protein L9 (Rpl9), mRNA. (723 bp)
gene="Rpl9" /codon_start=1 /product="60S ribosomal protein L9" /protein_id="NP_001007599.3" /db_xref="GeneID:29257" /db_xref="RGD:62049" /translation="MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQPDE" misc_feature 25..591 /gene="Rpl9" /note="Ribosomal protein L6; Region: Ribosomal_L6; cl30086" /db_xref="CDD:421973" misc_feature 385..387 /gene="Rpl9" /note="N6-acetyllysine. /evidence=ECO:0000250|UniProtKB:P32969; propagated from UniProtKB/Swiss-Prot...
AA_position 141
NM_001007598.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/rn/aa%3aKDEL
lang : en | div : | spe : rn | query_string : aa:KDEL | format : html | download :

0.000 | 0.000 | search_start;
0.154 | 0.154 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=(aa:KDEL)?source=Rattus norvegicus (Norway rat)?to=0&format=json
0.281 | 0.127 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=(aa:KDEL)?source=Rattus norvegicus (Norway rat)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.286 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]