LOCUS       NM_024385               1602 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus hematopoietically expressed homeobox (Hhex),
            mRNA.
ACCESSION   NM_024385
VERSION     NM_024385.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1602)
  AUTHORS   Wadey KS, Brown BA, Sala-Newby GB, Jayaraman PS, Gaston K and
            George SJ.
  TITLE     Protein kinase CK2 inhibition suppresses neointima formation via a
            proline-rich homeodomain-dependent mechanism
  JOURNAL   Vascul Pharmacol 99, 34-44 (2017)
   PUBMED   28927755
  REMARK    GeneRIF: Vascular smooth muscle protein kinase CK2 inhibition
            suppresses neointima formation via a proline-rich
            homeodomain-dependent mechanism.
REFERENCE   2  (bases 1 to 1602)
  AUTHORS   Simpson MT, Venkatesh I, Callif BL, Thiel LK, Coley DM, Winsor KN,
            Wang Z, Kramer AA, Lerch JK and Blackmore MG.
  TITLE     The tumor suppressor HHEX inhibits axon growth when prematurely
            expressed in developing central nervous system neurons
  JOURNAL   Mol Cell Neurosci 68, 272-283 (2015)
   PUBMED   26306672
  REMARK    GeneRIF: These findings suggest a role for HHEX in restricting axon
            growth in the developing central nervous system.
REFERENCE   3  (bases 1 to 1602)
  AUTHORS   Falix FA, Weeda VB, Labruyere WT, Poncy A, de Waart DR, Hakvoort
            TB, Lemaigre F, Gaemers IC, Aronson DC and Lamers WH.
  TITLE     Hepatic Notch2 deficiency leads to bile duct agenesis perinatally
            and secondary bile duct formation after weaning
  JOURNAL   Dev Biol 396 (2), 201-213 (2014)
   PUBMED   25446530
REFERENCE   4  (bases 1 to 1602)
  AUTHORS   Stuckey DW, Di Gregorio A, Clements M and Rodriguez TA.
  TITLE     Correct patterning of the primitive streak requires the anterior
            visceral endoderm
  JOURNAL   PLoS One 6 (3), e17620 (2011)
   PUBMED   21445260
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1602)
  AUTHORS   Williams H, Jayaraman PS and Gaston K.
  TITLE     DNA wrapping and distortion by an oligomeric homeodomain protein
  JOURNAL   J Mol Biol 383 (1), 10-23 (2008)
   PUBMED   18755198
REFERENCE   6  (bases 1 to 1602)
  AUTHORS   Keng VW, Yagi H, Ikawa M, Nagano T, Myint Z, Yamada K, Tanaka T,
            Sato A, Muramatsu I, Okabe M, Sato M and Noguchi T.
  TITLE     Homeobox gene Hex is essential for onset of mouse embryonic liver
            development and differentiation of the monocyte lineage
  JOURNAL   Biochem Biophys Res Commun 276 (3), 1155-1161 (2000)
   PUBMED   11027604
  REMARK    Erratum:[Biochem Biophys Res Commun 2000 Dec 20;279(2):739]
REFERENCE   7  (bases 1 to 1602)
  AUTHORS   Pellizzari L, D'Elia A, Rustighi A, Manfioletti G, Tell G and
            Damante G.
  TITLE     Expression and function of the homeodomain-containing protein Hex
            in thyroid cells
  JOURNAL   Nucleic Acids Res 28 (13), 2503-2511 (2000)
   PUBMED   10871399
REFERENCE   8  (bases 1 to 1602)
  AUTHORS   Martinez Barbera JP, Clements M, Thomas P, Rodriguez T, Meloy D,
            Kioussis D and Beddington RS.
  TITLE     The homeobox gene Hex is required in definitive endodermal tissues
            for normal forebrain, liver and thyroid formation
  JOURNAL   Development 127 (11), 2433-2445 (2000)
   PUBMED   10804184
REFERENCE   9  (bases 1 to 1602)
  AUTHORS   Brickman JM, Jones CM, Clements M, Smith JC and Beddington RS.
  TITLE     Hex is a transcriptional repressor that contributes to anterior
            identity and suppresses Spemann organiser function
  JOURNAL   Development 127 (11), 2303-2315 (2000)
   PUBMED   10804173
REFERENCE   10 (bases 1 to 1602)
  AUTHORS   Tanaka T, Inazu T, Yamada K, Myint Z, Keng VW, Inoue Y, Taniguchi N
            and Noguchi T.
  TITLE     cDNA cloning and expression of rat homeobox gene, Hex, and
            functional characterization of the protein
  JOURNAL   Biochem J 339 (Pt 1) (Pt 1), 111-117 (1999)
   PUBMED   10085234
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JACYVU010000047.1.
            
            On Nov 26, 2020 this sequence version replaced NM_024385.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: D86383.1, BC088135.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760383
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-375               JACYVU010000047.1  22211248-22211622
            376-554             JACYVU010000047.1  22213573-22213751
            555-605             JACYVU010000047.1  22213943-22213993
            606-1602            JACYVU010000047.1  22215839-22216835
FEATURES             Location/Qualifiers
     source          1..1602
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q53"
     gene            1..1602
                     /gene="Hhex"
                     /gene_synonym="Hex"
                     /note="hematopoietically expressed homeobox"
                     /db_xref="GeneID:79237"
                     /db_xref="RGD:619932"
     exon            1..375
                     /gene="Hhex"
                     /gene_synonym="Hex"
                     /inference="alignment:Splign:2.1.0"
     CDS             12..827
                     /gene="Hhex"
                     /gene_synonym="Hex"
                     /codon_start=1
                     /product="hematopoietically-expressed homeobox protein
                     HHEX"
                     /protein_id="NP_077361.1"
                     /db_xref="GeneID:79237"
                     /db_xref="RGD:619932"
                     /translation="

MQFPHPGPAAAPAVGVPLYAPTPLLQPAHPTPFYIDDILGRGPAAPTPTPTLPSPNSSFTSLVSSYRTPVYEPTPVHPAFSHHPAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWNPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKDELDSLDTSCDQGQDLPSEQNKGASLDSSQCSPSPASPEDPESEISEDSDQEVDIEGDKGYFNAG"

     misc_feature    order(426..440,444..446,495..497,513..515,552..554,
                     558..563,570..575,579..587,591..596)
                     /gene="Hhex"
                     /gene_synonym="Hex"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(432..434,441..443,561..563,570..575,582..584)
                     /gene="Hhex"
                     /gene_synonym="Hex"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    438..593
                     /gene="Hhex"
                     /gene_synonym="Hex"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            376..554
                     /gene="Hhex"
                     /gene_synonym="Hex"
                     /inference="alignment:Splign:2.1.0"
     exon            555..605
                     /gene="Hhex"
                     /gene_synonym="Hex"
                     /inference="alignment:Splign:2.1.0"
     exon            606..1602
                     /gene="Hhex"
                     /gene_synonym="Hex"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gcggagcagccatgcagttcccgcacccggggcccgcggctgcgcccgccgtcggagtcccgctgtacgcgcccacgccgctgctgcagcccgctcacccgacgcctttctacatcgacgacatcctgggtcgcgggcccgccgctcccacgcccactcccacgctgccgtcccccaactcctccttcaccagcctcgtgtcctcctaccggaccccggtgtacgagcccacgccggtccaccccgccttctcgcatcaccccgccgccgcgctggccgctgcctatggccccggtggcttcggaggccctctgtacccgttcccgcggacggtgaacgactacacgcacgccctactccgccacgaccccctgggcaagcccttgctctggaaccccttcctacagcgacctctgcacaaaaggaaaggcggtcaagtgaggttttccaacgaccagaccatcgagctggagaagaagttcgagactcagaaatacctctccccacctgagagaaagcgtctggccaagatgttgcagctcagcgagagacaggtcaaaacctggtttcagaatcgcagagctaaatggagacgactgaagcaggagaatcctcaaagcaataaaaaggatgagttggacagtttggacacttcctgtgaccagggccaagacttgcccagtgaacagaataaaggtgcctctttggacagttctcagtgttcaccctccccagcctctccggaagaccctgaatcagagatctcagaggattccgaccaggaagtggacatcgagggtgataaaggctattttaatgctggatgacagtcatcggccgtgaccatgttcagagactggactttagaataccgttctgctacagacaaactgggaaattctgagagaaagaagtaccattcttctagcgttttgaaaatatttggcacggcgtgcattgaaaccatacttttggtttagcgtacgttttccgtaccggtgttaagttgttttgataaagtggctaaatgtgacttcgtttttaaaaagtgaattctttctatttgtgagaagtaatttgaacttttgcctgaagcttaaactataactttaaaggttttgggcggctgttctcgaatgacttttcccaaatgtgtagctgttccctcgacttcagaggtgcacttagaaagggggccagcatttggggatccatggaatgctttcaaagagcacacttggtttttacgtgacaccttacattgctgccttaactccaaagccggttcagagcacttggcccctggtgtctgttctcataagcaagatagttgataagattcttacaatcttgttttgctcggccagtgcctctgaccctggtattaagggatgacgcagtctctacaggcagggaaactgactcacttgtgactgatctcacatgaactagaaatagcaggacaattaaatgtaagtagattgtagatagtgtgttttatagaaaccgtgtctatagcatgtgtatagaattattcgttgtaaaaaaaaccctgcaaaaatgtttgattttttttttaatttaatgaattaactttcatat

//