GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-27 20:29:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001004224            1231 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus B-cell receptor-associated protein 31 (Bcap31),
            mRNA.
ACCESSION   NM_001004224 XM_215226
VERSION     NM_001004224.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1231)
  AUTHORS   Li Y, Jain N, Limpanawat S, To J, Quistgaard EM, Nordlund P,
            Thanabalu T and Torres J.
  TITLE     Interaction between human BAP31 and respiratory syncytial virus
            small hydrophobic (SH) protein
  JOURNAL   Virology 482, 105-110 (2015)
   PUBMED   25854864
REFERENCE   2  (bases 1 to 1231)
  AUTHORS   Zhang C, Kho YS, Wang Z, Chiang YT, Ng GK, Shaw PC, Wang Y and Qi
            RZ.
  TITLE     Transmembrane and coiled-coil domain family 1 is a novel protein of
            the endoplasmic reticulum
  JOURNAL   PLoS One 9 (1), e85206 (2014)
   PUBMED   24454821
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1231)
  AUTHORS   Cacciagli P, Sutera-Sardo J, Borges-Correia A, Roux JC, Dorboz I,
            Desvignes JP, Badens C, Delepine M, Lathrop M, Cau P, Levy N,
            Girard N, Sarda P, Boespflug-Tanguy O and Villard L.
  TITLE     Mutations in BCAP31 cause a severe X-linked phenotype with
            deafness, dystonia, and central hypomyelination and disorganize the
            Golgi apparatus
  JOURNAL   Am J Hum Genet 93 (3), 579-586 (2013)
   PUBMED   24011989
REFERENCE   4  (bases 1 to 1231)
  AUTHORS   Iwasawa R, Mahul-Mellier AL, Datler C, Pazarentzos E and Grimm S.
  TITLE     Fis1 and Bap31 bridge the mitochondria-ER interface to establish a
            platform for apoptosis induction
  JOURNAL   EMBO J 30 (3), 556-568 (2011)
   PUBMED   21183955
REFERENCE   5  (bases 1 to 1231)
  AUTHORS   Ghosh D, Lippert D, Krokhin O, Cortens JP and Wilkins JA.
  TITLE     Defining the membrane proteome of NK cells
  JOURNAL   J Mass Spectrom 45 (1), 1-25 (2010)
   PUBMED   19946888
REFERENCE   6  (bases 1 to 1231)
  AUTHORS   Pang AL, Taylor HC, Johnson W, Alexander S, Chen Y, Su YA, Li X,
            Ravindranath N, Dym M, Rennert OM and Chan WY.
  TITLE     Identification of differentially expressed genes in mouse
            spermatogenesis
  JOURNAL   J Androl 24 (6), 899-911 (2003)
   PUBMED   14581517
REFERENCE   7  (bases 1 to 1231)
  AUTHORS   Bell AW, Ward MA, Blackstock WP, Freeman HN, Choudhary JS, Lewis
            AP, Chotai D, Fazel A, Gushue JN, Paiement J, Palcy S, Chevet E,
            Lafreniere-Roula M, Solari R, Thomas DY, Rowley A and Bergeron JJ.
  TITLE     Proteomics characterization of abundant Golgi membrane proteins
  JOURNAL   J Biol Chem 276 (7), 5152-5165 (2001)
   PUBMED   11042173
REFERENCE   8  (bases 1 to 1231)
  AUTHORS   Annaert WG, Becker B, Kistner U, Reth M and Jahn R.
  TITLE     Export of cellubrevin from the endoplasmic reticulum is controlled
            by BAP31
  JOURNAL   J Cell Biol 139 (6), 1397-1410 (1997)
   PUBMED   9396746
REFERENCE   9  (bases 1 to 1231)
  AUTHORS   Li E, Bestagno M and Burrone O.
  TITLE     Molecular cloning and characterization of a transmembrane surface
            antigen in human cells
  JOURNAL   Eur J Biochem 238 (3), 631-638 (1996)
   PUBMED   8706661
REFERENCE   10 (bases 1 to 1231)
  AUTHORS   Adachi T, Schamel WW, Kim KM, Watanabe T, Becker B, Nielsen PJ and
            Reth M.
  TITLE     The specificity of association of the IgD molecule with the
            accessory proteins BAP31/BAP29 lies in the IgD transmembrane
            sequence
  JOURNAL   EMBO J 15 (7), 1534-1541 (1996)
   PUBMED   8612576
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC079182.1.
            
            On Sep 10, 2004 this sequence version replaced XM_215226.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC079182.1, FQ219790.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN16676811 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1231
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq37"
     gene            1..1231
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="B-cell receptor-associated protein 31"
                     /db_xref="GeneID:293852"
                     /db_xref="RGD:1302944"
     exon            1..44
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            45..180
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     CDS             89..826
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /codon_start=1
                     /product="B-cell receptor-associated protein 31"
                     /protein_id="NP_001004224.1"
                     /db_xref="GeneID:293852"
                     /db_xref="RGD:1302944"
                     /translation="
MSLQWTAVATFLYAEVFAVLLLCIPFISPKRWQKIFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGTAEDGGKLDVGSPEMKLEENKILKTDLKKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSDKKEE"
     misc_feature    89..496
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="B-cell receptor-associated protein 31-like; Region:
                     Bap31; pfam05529"
                     /db_xref="CDD:428511"
     misc_feature    662..823
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="Bap31/Bap29 cytoplasmic coiled-coil domain; Region:
                     Bap31_Bap29_C; pfam18035"
                     /db_xref="CDD:436226"
     exon            181..281
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            282..429
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            430..565
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            566..686
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            687..787
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            788..1205
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gagtttggtagttgcagtggggcgtgcgcgtaggctgaaactcggaaacaagctcctatccatctgttggaaacctttaagtcacaggatgagtctgcagtggactgcagttgccaccttcctctacgcagaggtctttgctgtgttgcttctctgcattcccttcatttctcccaaaagatggcagaagatttttaaatctcggctggttgagttggtagtgacctatggcaacactttctttgtggttctcatcgtcatccttgtgctgttggtcattgatgctgtacgtgagatccggaaatatgatgatgtaacagaaaaggtgaacctccagaacaatccaggtgccatggagcacttccacatgaagcttttccgtgctcagaggaatctctatattgctggcttttccttgctgctgtccttcctgcttagacgcctggtgactctcatctcccagcaggccacactgctggcctccaatgaagcctttaaaaagcaggcagaaagtgccagtgaggcagccaagaaatacatggaggagaatgatcagctaaagaagggaactgctgaggatggaggcaagttggatgttgggagtcctgaaatgaagttagaggagaacaagatcctgaagactgatctgaagaagctaaaagatgagctggccagcaccaagaaaaaacttgagaaagctgaaaacgaggctctggctatgcagaagcagtctgagggccttaccaaagaatatgaccgtctgctagaagagcacgccaagctgcaggcctcagtacgtggtccctcagacaagaaggaggagtaaagacttggtttttccctgcctgtagctggcttatacttgacccatgcttactgcttccttggagcccagcctgtccctctggtacttggtttattcccttccatttccccaattttcttccatggcttatagatcattttggccccattacacatactactcttataccaaaaaggacctgattgttgttcattcacagtaattttgccactgttctgcctggccagggcactttccactcctagaagtgtagaaaagcactggtgacctgggctgcacttgtactccattttattttgccatgtatcctaaaagaggctgctgttaagcaggtcaactgttttatcctgaggggaataaatgttgttatgttacaaggaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]