LOCUS       NM_001399249            2649 bp    mRNA    linear   ROD 02-OCT-2023
DEFINITION  Rattus norvegicus methyltransferase 14,
            N6-adenosine-methyltransferase subunit (Mettl14), mRNA.
ACCESSION   NM_001399249 XM_006233266
VERSION     NM_001399249.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2649)
  AUTHORS   Li Y, Li J, Yu Q, Ji L and Peng B.
  TITLE     METTL14 regulates microglia/macrophage polarization and NLRP3
            inflammasome activation after ischemic stroke by the KAT3B-STING
            axis
  JOURNAL   Neurobiol Dis 185, 106253 (2023)
   PUBMED   37541353
  REMARK    GeneRIF: METTL14 regulates microglia/macrophage polarization and
            NLRP3 inflammasome activation after ischemic stroke by the
            KAT3B-STING axis.
REFERENCE   2  (bases 1 to 2649)
  AUTHORS   Wang C, Zhu X, Chen R, Zhang X and Lian N.
  TITLE     Upregulation of UBR1 m6A Methylation by METTL14 Inhibits Autophagy
            in Spinal Cord Injury
  JOURNAL   eNeuro 10 (6) (2023)
   PUBMED   37094938
  REMARK    GeneRIF: Upregulation of UBR1 m6A Methylation by METTL14 Inhibits
            Autophagy in Spinal Cord Injury.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2649)
  AUTHORS   Li X, Xu X, Zhang Q, Ling M, Li X and Tan X.
  TITLE     METTL14 promotes fibroblast-like synoviocytes activation via the
            LASP1/SRC/AKT axis in rheumatoid arthritis
  JOURNAL   Am J Physiol Cell Physiol 324 (5), C1089-C1100 (2023)
   PUBMED   36878846
  REMARK    GeneRIF: METTL14 promotes fibroblast-like synoviocytes activation
            via the LASP1/SRC/AKT axis in rheumatoid arthritis.
REFERENCE   4  (bases 1 to 2649)
  AUTHORS   Meng L, Lin H, Huang X, Weng J, Peng F and Wu S.
  TITLE     METTL14 suppresses pyroptosis and diabetic cardiomyopathy by
            downregulating TINCR lncRNA
  JOURNAL   Cell Death Dis 13 (1), 38 (2022)
   PUBMED   35013106
  REMARK    GeneRIF: METTL14 suppresses pyroptosis and diabetic cardiomyopathy
            by downregulating TINCR lncRNA.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2649)
  AUTHORS   Feng MG, Yang SL, Luo DW, Peng SL, Lou FZ and Xiao JG.
  TITLE     [Osteogenic Capacity and Mettl14 and Notch1 Expression of
            Adipose-Derived Stem Cells from Osteoporotic Rats]
  JOURNAL   Sichuan Da Xue Xue Bao Yi Xue Ban 52 (3), 423-429 (2021)
   PUBMED   34018360
  REMARK    GeneRIF: [Osteogenic Capacity and Mettl14 and Notch1 Expression of
            Adipose-Derived Stem Cells from Osteoporotic Rats].
REFERENCE   6  (bases 1 to 2649)
  AUTHORS   Zhou J, Wan J, Gao X, Zhang X, Jaffrey SR and Qian SB.
  TITLE     Dynamic m(6)A mRNA methylation directs translational control of
            heat shock response
  JOURNAL   Nature 526 (7574), 591-594 (2015)
   PUBMED   26458103
REFERENCE   7  (bases 1 to 2649)
  AUTHORS   Liu N, Dai Q, Zheng G, He C, Parisien M and Pan T.
  TITLE     N(6)-methyladenosine-dependent RNA structural switches regulate
            RNA-protein interactions
  JOURNAL   Nature 518 (7540), 560-564 (2015)
   PUBMED   25719671
REFERENCE   8  (bases 1 to 2649)
  AUTHORS   Schwartz S, Mumbach MR, Jovanovic M, Wang T, Maciag K, Bushkin GG,
            Mertins P, Ter-Ovanesyan D, Habib N, Cacchiarelli D, Sanjana NE,
            Freinkman E, Pacold ME, Satija R, Mikkelsen TS, Hacohen N, Zhang F,
            Carr SA, Lander ES and Regev A.
  TITLE     Perturbation of m6A writers reveals two distinct classes of mRNA
            methylation at internal and 5' sites
  JOURNAL   Cell Rep 8 (1), 284-296 (2014)
   PUBMED   24981863
REFERENCE   9  (bases 1 to 2649)
  AUTHORS   Wang Y, Li Y, Toth JI, Petroski MD, Zhang Z and Zhao JC.
  TITLE     N6-methyladenosine modification destabilizes developmental
            regulators in embryonic stem cells
  JOURNAL   Nat Cell Biol 16 (2), 191-198 (2014)
   PUBMED   24394384
REFERENCE   10 (bases 1 to 2649)
  AUTHORS   Liu J, Yue Y, Han D, Wang X, Fu Y, Zhang L, Jia G, Yu M, Lu Z, Deng
            X, Dai Q, Chen W and He C.
  TITLE     A METTL3-METTL14 complex mediates mammalian nuclear RNA
            N6-adenosine methylation
  JOURNAL   Nat Chem Biol 10 (2), 93-95 (2014)
   PUBMED   24316715
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000078.1.
            
            On Jan 5, 2022 this sequence version replaced XM_006233266.4.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC166789.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000350]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-217               JACYVU010000078.1  10212237-10212453   c
            218-306             JACYVU010000078.1  10209974-10210062   c
            307-394             JACYVU010000078.1  10209115-10209202   c
            395-475             JACYVU010000078.1  10207627-10207707   c
            476-563             JACYVU010000078.1  10207183-10207270   c
            564-654             JACYVU010000078.1  10203169-10203259   c
            655-796             JACYVU010000078.1  10201794-10201935   c
            797-889             JACYVU010000078.1  10201030-10201122   c
            890-1006            JACYVU010000078.1  10200546-10200662   c
            1007-1217           JACYVU010000078.1  10199210-10199420   c
            1218-2649           JACYVU010000078.1  10196206-10197637   c
FEATURES             Location/Qualifiers
     source          1..2649
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="2"
                     /map="2q42"
     gene            1..2649
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /note="methyltransferase 14,
                     N6-adenosine-methyltransferase subunit"
                     /db_xref="GeneID:295428"
                     /db_xref="RGD:1304822"
     exon            1..217
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
     CDS             152..1522
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /EC_number="2.1.1.62"
                     /note="methyltransferase-like protein 14;
                     N6-adenosine-methyltransferase subunit METTL14;
                     methyltransferase like 14"
                     /codon_start=1
                     /product="N6-adenosine-methyltransferase non-catalytic
                     subunit"
                     /protein_id="NP_001386178.1"
                     /db_xref="GeneID:295428"
                     /db_xref="RGD:1304822"
                     /translation="

MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNSKRKCLDEGETDEDKVEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGIAANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGTHRGGFTPR"

     misc_feature    707..1240
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /note="Region: MT-A70; pfam05063"
                     /db_xref="CDD:368270"
     exon            218..306
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
     exon            307..394
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
     exon            395..475
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
     exon            476..563
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
     exon            564..654
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
     exon            655..796
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
     exon            797..889
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
     exon            890..1006
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
     exon            1007..1217
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
     exon            1218..2649
                     /gene="Mettl14"
                     /gene_synonym="RGD1304822"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gcctgtctcgggcgcgccggaaatccctcctgagggacgtgaaagtctccgggtcagaatctcggtgggacgctgtttcctggtttgggaggagggtttgcgttttggcgggcgcggtgtctgtcgggtggtgagaagcaggacctggggcatggacagccgcctgcaggagatccgggaacggcagaagttacggcggcagctcctagctcagcagttgggagctgagagtgcagatagcattggtgctgtgttaaacagcaaagatgaacagagggagatcgctgaaacaagagaaacttgcagggcttcctatgatacttctgctccaaattcaaaacggaagtgtctggatgaaggagagacggatgaagataaagtagaagaatataaggatgaactagaaatgcaacaggaagaagaaaatttgccatatgaagaagagatttacaaagattccagtaccttccttaagggaacgcagagcttaaatccccataatgattactgccagcattttgtagacactggacatagacctcagaatttcatcagggatgtaggcctagccgacagatttgaagaataccctaaacttagggagctcatcagactgaaggatgagctgatagctaagtcaaatactcctcccatgtacttacaggcagacatagaagcctttgacatcagagaattgacacccaagtttgatgtgattcttctggagcctcctctggaagaatactacagagagaccggcatcgctgcaaacgagaagtgctggacgtgggacgatatcatgaagttagaaatcgatgagatcgcagcacctcggtcatttatatttctctggtgcggctctggggaaggattggaccttgggagagtatgtttgcgaaagtggggttacagaagatgtgaagatatttgttggattaaaaccaataagaacaatcctggaaagacaaagaccctagatccaaaggccgttttccagaggacaaaggagcactgccttatggggatcaaaggaaccgtgaagcgaagcacagatggggacttcattcatgctaatgttgacattgacttaattatcacagaggaacctgagattggcaacatagaaaagcccgtggagatttttcacataatagagcacttttgtctcggtagaagacgccttcatctcttcgggagggacagcactatcaggccaggctggctcacagttggaccaacgcttacaaatagtaactacaatgcagaaacctacgcgtcctacttcagtgcccccaattcatacttgactggatgtaccgaggaaattgagaggcttagaccgaagtcacctcctcccaaatccaagtctgaccgtggtggtggagctcccagaggtggagggagagggggaacatctgctggccgtggtcgtgaacgaaatcgatccaatttccgaggagaaagaggtggctttagggggggtcgtggagggacacacagaggtggctttacacctcggtagctgttacaaacgcttaacagtgtcccctctgatcttttttgtgaagacttgcttcagaactcactcccagcttgcactttgctttagtttctcatgctgccagaaagaccttagccacccacccccacccctaggtccttgcagttgtcacagactgtggttctgctcagggtaagtcacatgtgtgcaacactcagtcatgggcttgactgatttcactcaaggctttggcttcttggaaataggagcgcagtggagcacctctcagaggaggatggcaggaatggtgctctttccttgtcgtggctgccgcagccgcagtaggagactgggaacctgggcagagcagaactgagagaggcggtcaccctttttggggcctttaatgttttcttgttaaaacactaaaaagatgtagttcccccccccccttttaaattctaaaaaataacatgaagtatcatttgagtactgaagactcagagatgaaatgaagtcactttcttccagatctgaatctgacggggctggagccctcagggaaggtaatggaagaggcagagcttcctagatttaaaacaaaagcaaaacaaaaaccaaagttatcataatgtaaataacagctgcagatgacatataatcatgcttcttaagaagcaagaggaggcaggcacgtgtcaggtcggagggctgtgtgtgatcttgaacttggactgaccttctaagacaattcatatttcttagcaaaggtaaaaacagatttgctggggggagggatggttcaaacaatctagaaaataaacgcttgatgatgaggaaatgacatacatctttaaagttgttattgaacaaaatttaggtaaaagcaattatagaaaccctaaggatacagcttgagagatggggttgcagttgcctttgattagagctgtgtggtgcagatgtctctgcagggctgatgttcggatctcttggctgtggaaagcttcatactgttgtttttctacaccttaagtcatgtttgaatggatttggctatgccagatgagataatatcattattgttcatggtaactcctttttttattttgctatacttttctaataaaaagtttaaacctttgaaa

//