LOCUS       NM_001007598             723 bp    mRNA    linear   ROD 02-JUL-2023
DEFINITION  Rattus norvegicus ribosomal protein L9 (Rpl9), mRNA.
ACCESSION   NM_001007598 XM_341213
VERSION     NM_001007598.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 723)
  AUTHORS   Zanivan S, Maione F, Hein MY, Hernandez-Fernaud JR, Ostasiewicz P,
            Giraudo E and Mann M.
  TITLE     SILAC-based proteomics of human primary endothelial cell
            morphogenesis unveils tumor angiogenic markers
  JOURNAL   Mol Cell Proteomics 12 (12), 3599-3611 (2013)
   PUBMED   23979707
REFERENCE   2  (bases 1 to 723)
  AUTHORS   Anger AM, Armache JP, Berninghausen O, Habeck M, Subklewe M, Wilson
            DN and Beckmann R.
  TITLE     Structures of the human and Drosophila 80S ribosome
  JOURNAL   Nature 497 (7447), 80-85 (2013)
   PUBMED   23636399
REFERENCE   3  (bases 1 to 723)
  AUTHORS   de Mateo S, Castillo J, Estanyol JM, Ballesca JL and Oliva R.
  TITLE     Proteomic characterization of the human sperm nucleus
  JOURNAL   Proteomics 11 (13), 2714-2726 (2011)
   PUBMED   21630459
REFERENCE   4  (bases 1 to 723)
  AUTHORS   Kuo JC, Han X, Hsiao CT, Yates JR 3rd and Waterman CM.
  TITLE     Analysis of the myosin-II-responsive focal adhesion proteome
            reveals a role for beta-Pix in negative regulation of focal
            adhesion maturation
  JOURNAL   Nat Cell Biol 13 (4), 383-393 (2011)
   PUBMED   21423176
REFERENCE   5  (bases 1 to 723)
  AUTHORS   Ghosh D, Lippert D, Krokhin O, Cortens JP and Wilkins JA.
  TITLE     Defining the membrane proteome of NK cells
  JOURNAL   J Mass Spectrom 45 (1), 1-25 (2010)
   PUBMED   19946888
REFERENCE   6  (bases 1 to 723)
  AUTHORS   Odintsova TI, Muller EC, Ivanov AV, Egorov TA, Bienert R,
            Vladimirov SN, Kostka S, Otto A, Wittmann-Liebold B and Karpova GG.
  TITLE     Characterization and analysis of posttranslational modifications of
            the human large cytoplasmic ribosomal subunit proteins by mass
            spectrometry and Edman sequencing
  JOURNAL   J Protein Chem 22 (3), 249-258 (2003)
   PUBMED   12962325
REFERENCE   7  (bases 1 to 723)
  AUTHORS   Angelastro JM, Torocsik B and Greene LA.
  TITLE     Nerve growth factor selectively regulates expression of transcripts
            encoding ribosomal proteins
  JOURNAL   BMC Neurosci 3, 3 (2002)
   PUBMED   11922865
REFERENCE   8  (bases 1 to 723)
  AUTHORS   Monach PA, Meredith SC, Siegel CT and Schreiber H.
  TITLE     A unique tumor antigen produced by a single amino acid substitution
  JOURNAL   Immunity 2 (1), 45-59 (1995)
   PUBMED   7600302
REFERENCE   9  (bases 1 to 723)
  AUTHORS   Suzuki K, Olvera J and Wool IG.
  TITLE     The primary structure of rat ribosomal protein L9
  JOURNAL   Gene 93 (2), 297-300 (1990)
   PUBMED   2227441
REFERENCE   10 (bases 1 to 723)
  AUTHORS   Tsurugi,K., Collatz,E., Wool,E.G. and Lin,A.
  TITLE     Isolation of eukaryotic ribosomal proteins. Purification and
            characterization of the 60 S ribosomal subunit proteins L4, L5, L7,
            L9, L11, L12, L13, L21, L22, L23, L26, L27, L30, L33, L35', L37,
            and L39
  JOURNAL   J Biol Chem 251 (24), 7940-7946 (1976)
   PUBMED   1002715
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC060589.1 and BC086561.1.
            
            On Apr 13, 2007 this sequence version replaced NM_001007598.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC060589.1, CB314568.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-18                BC060589.1         5-22
            19-723              BC086561.1         1-705
FEATURES             Location/Qualifiers
     source          1..723
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="14"
                     /map="14p11"
     gene            1..723
                     /gene="Rpl9"
                     /note="ribosomal protein L9"
                     /db_xref="GeneID:29257"
                     /db_xref="RGD:62049"
     exon            1..23
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            24..70
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     CDS             25..603
                     /gene="Rpl9"
                     /note="60S ribosomal protein L9"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL6"
                     /protein_id="NP_001007599.3"
                     /db_xref="GeneID:29257"
                     /db_xref="RGD:62049"
                     /translation="

MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQPDE"

     misc_feature    25..591
                     /gene="Rpl9"
                     /note="60S ribosomal protein L6; Provisional; Region:
                     PTZ00027"
                     /db_xref="CDD:240234"
     misc_feature    385..387
                     /gene="Rpl9"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P32969; propagated from
                     UniProtKB/Swiss-Prot (P17077.1); acetylation site"
     exon            71..186
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            187..282
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            283..415
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            416..496
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            497..611
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
     exon            612..690
                     /gene="Rpl9"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ctctttgccccatctactgcgagaatgaagaccattctcagcaatcagactgtcgacattccagaaaatgtcgacatcactctgaaggggcgcacagtcattgtgaagggccccagaggaactctgaggagggacttcaatcacatcaatgtagagctgagtcttcttggaaagaaaaagaaaaggctccgtgttgacaagtggtggggtaacaggaaggaactggccactgtcagaaccatctgcagtcatgttcagaacatgatcaagggtgtgacactgggcttccgttacaagatgaggtctgtgtatgctcacttccctatcaacgtcgttattcaggagaatgggtctctggttgaaatccgaaatttcttgggtgaaaaatacatccggagggttcggatgaggacaggtgttgcttgttctgtctctcaagcccagaaggatgagttaatccttgaaggaaatgatattgaacttgtttcaaattcagcggctctgattcagcaagccacaacagttaaaaacaaggatatcaggaagtttttggatggcatctatgtttctgagaagggaaccgtccagcagcctgacgaatgagacctcagtttcctagcttcagaaacaagatcctgataacaagtacagtttgggctctgtggaaacaataaaagacttatatattgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa

//