ver.2
Help
|
Advanced search
|
Japanese
Previous release (v1)
2024-05-04 07:18:01, GGRNA : RefSeq release 222 (Jan, 2024)
Summary:
Results:
Matches are highlighted with green background.
Overlapping matches are dark colored.
locus_tag="AWJ20_395" /inference="similar to AA sequence:KEGG_Orthology:K11778" /note="Cis-prenyltransferase involved in dolichol synthesis; major enzyme of polyprenol synthesis in both the endoplasmic reticulum (ER) and in lipid droplets; participates in ER protein sorting; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11442630]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 24868093]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 9858571]; GO_component: GO...
XM_018880991.1 -
Sugiyamaella lignohabitans -
NCBI
CERS2, a tumor metastasis suppressor gene whose silencing enahnces invasion/metastasis of prostate cancer cells; LAG1 has a paralog, LAC1, that arose from the whole genome duplication; GO_component: GO:0061576 - acyl-CoA ceramide synthase complex [Evidence IDA] [PMID 15692566]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 22842922]; GO_component...
XM_018881631.1 -
Sugiyamaella lignohabitans -
NCBI
CERS2, a tumor metastasis suppressor gene whose silencing enahnces invasion/metastasis of prostate cancer cells; LAG1 has a paralog, LAC1, that arose from the whole genome duplication; GO_component: GO:0061576 - acyl-CoA ceramide synthase complex [Evidence IDA] [PMID 15692566]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 22842922]; GO_component...
XM_018878309.1 -
Sugiyamaella lignohabitans -
NCBI
CDS 1..837 /gene="ERJ5" /locus_tag="AWJ20_2354" /note="Type I membrane protein with a J domain; required to preserve the folding capacity of the endoplasmic reticulum; loss of the non-essential ERJ5 gene leads to a constitutively induced unfolded protein response; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 17157937]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 -...
XM_018879293.1 -
Sugiyamaella lignohabitans -
NCBI
protein response; Orm1p and Orm2p together control membrane biogenesis by coordinating lipid homeostasis with protein quality control; ORM1 has a paralog, ORM2, that arose from the whole genome duplication; GO_component: GO:0035339 - SPOTS complex [Evidence IDA] [PMID 20182505]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 20182505]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018882133.1 -
Sugiyamaella lignohabitans -
NCBI
YET3" /locus_tag="AWJ20_835" /inference="similar to AA sequence:KEGG_Orthology:K14009" /note="hypothetical protein; YET3 null mutant decreases the level of secreted invertase; homolog of human BAP31 protein; protein abundance increases in response to DNA replication stress; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 20378542]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018882803.1 -
Sugiyamaella lignohabitans -
NCBI
component of the sterol acetylation/deacetylation cycle along with Atf2p; active both in the endoplasmic reticulum (ER) and in lipid droplets; integral membrane protein with active site in the ER lumen; green fluorescent protein (GFP)-fusion protein localizes to the ER; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 24868093]; GO_component: GO:0005788 - endoplasmic reticulum lumen [Evidence IDA] [PMID 18034159]; GO_component:...
XM_018880969.1 -
Sugiyamaella lignohabitans -
NCBI
component of the sterol acetylation/deacetylation cycle along with Atf2p; active both in the endoplasmic reticulum (ER) and in lipid droplets; integral membrane protein with active site in the ER lumen; green fluorescent protein (GFP)-fusion protein localizes to the ER; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 24868093]; GO_component: GO:0005788 - endoplasmic reticulum lumen [Evidence IDA] [PMID 18034159]; GO_component:...
XM_018879924.1 -
Sugiyamaella lignohabitans -
NCBI
in response to treatment with 8-methoxypsoralen and UVA irradiation; relocalizes from ER to cytoplasm upon DNA replication stress; ECM3 has a paralog, YNL095C, that arose from the whole genome duplication; GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID 22842922]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 22842922]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018881650.1 -
Sugiyamaella lignohabitans -
NCBI
trans isomerization of peptide bonds N-terminal to proline residues; transcriptionally induced in response to unfolded proteins in the ER; CPR5 has a paralog, CPR2, that arose from the whole genome duplication; GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 8377189]; GO_component: GO:0005788 - endoplasmic reticulum lumen [Evidence IEA]; GO_function: GO...
XM_018880661.1 -
Sugiyamaella lignohabitans -
NCBI
sequence:KEGG_Orthology:K08288" /note="Glucosidase II beta subunit, forms a complex with alpha subunit Rot2p; involved in removal of two glucose residues from N-linked glycans during glycoprotein biogenesis in the ER; relocalizes from ER to cytoplasm upon DNA replication stress; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 22842922]; GO_component: GO:0005788 - endoplasmic reticulum lumen [Evidence IDA] [PMID 16373354]; GO...
XM_018879613.1 -
Sugiyamaella lignohabitans -
NCBI
in the ER; interacts with the Dsl1p complex through Tip20p; GO_component: GO:0031201 - SNARE complex [Evidence IDA] [PMID 12853481]; GO_component: GO:0031201 - SNARE complex [Evidence IDA] [PMID 12893879]; GO_component: GO:0031201 - SNARE complex [Evidence IDA] [PMID 9214619]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 8334998]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018881312.1 -
Sugiyamaella lignohabitans -
NCBI
GeneID:30035203" CDS 1..1368 /gene="WBP1" /locus_tag="AWJ20_3206" /inference="similar to AA sequence:KEGG_Orthology:K12670" /note="Beta subunit of the oligosaccharyl transferase glycoprotein complex; required for N-linked glycosylation of proteins in the endoplasmic reticulum; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 12860997]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 1724755]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA,IEA]; GO_component: GO...
XM_018880214.1 -
Sugiyamaella lignohabitans -
NCBI
transporter; part of a heterodimeric transporter with Msc2p that transfers zinc from the cytosol to the ER lumen; member of the cation diffusion facilitator family of efflux pumps; zinc-regulated directly through Zap1p; transcription induced under conditions of zinc deficiency; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 15961382]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018882884.1 -
Sugiyamaella lignohabitans -
NCBI
transfer between the ER and mitochondria; RTN1 has a paralog, RTN2, that arose from the whole genome duplication; GO_component: GO:0005794 - Golgi apparatus [Evidence IDA] [PMID 16002643]; GO_component: GO:0032541 - cortical endoplasmic reticulum [Evidence IDA] [PMID 16624861]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 16002643]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018881454.1 -
Sugiyamaella lignohabitans -
NCBI
; an enzyme that catalyzes that conversion of CTP + phosphate into diphosphate + CDP-diaclglyerol, a critical step in the synthesis of all major yeast phospholipids; GO_component: GO:0070319 - Golgi to plasma membrane transport vesicle [Evidence IDA] [PMID 2163397]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 23623749]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 8557688]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018878350.1 -
Sugiyamaella lignohabitans -
NCBI
component: GO:0005794 - Golgi apparatus [Evidence IEA]; GO_component: GO:0005794 - Golgi apparatus [Evidence IDA] [PMID 12459470]; GO_component: GO:0000139 - Golgi membrane [Evidence IEA]; GO_component: GO:0032541 - cortical endoplasmic reticulum [Evidence IDA] [PMID 17686782]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 12493772]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 16141212]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018880669.1 -
Sugiyamaella lignohabitans -
NCBI
similar to AA sequence:KEGG_Orthology:K13519" /note="Broad-specificity lysophospholipid acyltransferase; part of MBOAT family of membrane-bound O-acyltransferases; key component of Lands cycle; may have role in fatty acid exchange at sn-2 position of mature glycerophospholipids; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 17890783]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018879510.1 -
Sugiyamaella lignohabitans -
NCBI
AA sequence:KEGG_Orthology:K13507" /note="Glycerol 3-phosphate/dihydroxyacetone phosphate sn-1 acyltransferase; dual substrate-specific acyltransferase of the glycerolipid biosynthesis pathway; prefers 16-carbon fatty acids; similar to Gpt2p; gene is constitutively transcribed; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 19525420]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018878300.1 -
Sugiyamaella lignohabitans -
NCBI
Qualifiers source 1..897 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="I" gene 897 /gene="PRM9" /locus_tag="YAR031W" /db_xref="GeneID:851282" CDS 1..897 /gene="PRM9" /locus_tag="YAR031W" /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic reticulum [PMID:26928762]" /experiment="EXISTENCE:direct assay:GO:0005886 plasma membrane [PMID:12101299]" /experiment="EXISTENCE:physical interaction:GO:0005783 endoplasmic reticulum [PMID:12925749]" /note="Pheromone-regulated protein; contains 3 predicted transmembrane segments and an...
NM_001178224.1 -
Saccharomyces cerevisiae S288C -
NCBI
in phytosphingosine synthesis; essential for growth in the absence of exogenous dihydrosphingosine or phytosphingosine; localized to lipid droplets; member of short chain dehydrogenase/reductase protein family; GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...
XM_018879960.1 -
Sugiyamaella lignohabitans -
NCBI
Qualifiers source 1..705 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="I" gene 705 /gene="MST28" /locus_tag="YAR033W" /db_xref="GeneID:851284" CDS 1..705 /gene="MST28" /locus_tag="YAR033W" /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic reticulum [PMID:12925749|PMID:26928762]" /experiment="EXISTENCE:direct assay:GO:0005794 Golgi apparatus [PMID:12925749]" /experiment="EXISTENCE:direct assay:GO:0016020 membrane [PMID:12925749]" /experiment="EXISTENCE:genetic interaction:GO:0016050 vesicle organization...
NM_001178225.1 -
Saccharomyces cerevisiae S288C -
NCBI
involved in regulation of sterol biosynthesis; specifically stabilizes Hmg2p, one of two HMG-CoA isoenzymes that catalyze the rate-limiting step in sterol biosynthesis; homolog of mammalian INSIG proteins; NSG2 has a paralog, NSG1, that arose from the whole genome duplication; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016020 -...
XM_018880185.1 -
Sugiyamaella lignohabitans -
NCBI
tag="AWJ20_3472" /inference="similar to AA sequence:KEGG_Orthology:K14001" /note="Nucleotide exchange factor for the ER lumenal Hsp70 chaperone Kar2p; required for protein translocation into the endoplasmic reticulum (ER); homolog of Yarrowia lipolytica SLS1; GrpE-like protein; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IPI] [PMID 10958688]; GO_component: GO:0005788 - endoplasmic reticulum lumen [Evidence IEA]; GO_function: GO:0000774 - adenyl-nucleotide exchange factor activity [Evidence IDA,IPI]...
XM_018880491.1 -
Sugiyamaella lignohabitans -
NCBI
CDS 1..480 /gene="ERG2" /locus_tag="AWJ20_2679" /inference="similar to AA sequence:KEGG_Orthology:K09829" /note="C-8 sterol isomerase; catalyzes the isomerization of the delta-8 double bond to the delta-7 position at an intermediate step in ergosterol biosynthesis; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IC] [PMID 18459942]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016020 - membrane...
XM_018879638.1 -
Sugiyamaella lignohabitans -
NCBI
KEGG_Orthology:K07541" /note="Component of glycosylphosphatidylinositol-mannosyltransferase I; essential component; required for the autocatalytic post-translational processing of the protease B precursor Prb1p; localizes to ER in lumenal orientation; homolog of mammalian PIG-X; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 9649520]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA,IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO...
XM_018881475.1 -
Sugiyamaella lignohabitans -
NCBI
GeneID:30036498" CDS 1..807 /gene="THI73" /locus_tag="AWJ20_4373" /note="Putative plasma membrane permease; proposed to be involved in carboxylic acid uptake and repressed by thiamine; substrate of Dbf2p/Mob1p kinase; transcription is altered if mitochondrial dysfunction occurs; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 16850348]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA,IEA]; GO_component: GO...
XM_018881437.1 -
Sugiyamaella lignohabitans -
NCBI
Qualifiers source 1..714 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="VII" gene 714 /gene="PRM8" /locus_tag="YGL053W" /db_xref="GeneID:852828" CDS 1..714 /gene="PRM8" /locus_tag="YGL053W" /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic reticulum [PMID:12925749]" /experiment="EXISTENCE:mutant phenotype:GO:0005783 endoplasmic reticulum [PMID:12101299]" /experiment="EXISTENCE:mutant phenotype:GO:0005886 plasma membrane [PMID:12101299]" /note="Pheromone-regulated protein; contains with 2 predicted transmembrane segments...
NM_001180918.1 -
Saccharomyces cerevisiae S288C -
NCBI
GeneID:30035689" CDS 1..864 /gene="TED1" /locus_tag="AWJ20_3644" /note="Conserved phosphoesterase domain-containing protein; acts together with Emp24p/Erv25p in cargo exit from the ER; deletion confers sensitivity to 4-(N-(S-glutathionylacetyl)amino) phenylarsenoxide (GSAO); GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016020 -...
XM_018880675.1 -
Sugiyamaella lignohabitans -
NCBI
added_literature=pmid:18054093;curatorN ame=ucb@sanger.ac.uk; term=annotation;date=20180829;qualifier=removed_product=si gnal peptidase complex subunit SPC2, putative;qualifier=added_product=signal peptidase complex subunit 2, putative;qualifier=added_literature=pmid:30127496;qualifie r=added_GO:0005783;qualifier=added_GO:0045047;qualifier=ad ded_GO:0005787;curatorName=ucb@sanger.ac.uk; pfam_scan;Pfam:PF06703.7; E()=3.0E-9;score=36.7;query 26-171;description=SPC25; iprscan;InterPro:IPR009582 : Microsomal signal peptidase 25 kDa subunit;Pfam:PF06703; score=4.0E-9;query 26-171;description=Signal...
XM_016798883.1 -
Plasmodium chabaudi chabaudi -
NCBI
to AA sequence:KEGG_Orthology:K05287" /note="ER membrane protein involved in a late step of GPI anchor assembly; involved in the addition of phosphoethanolamine to the multiply mannosylated glycosylphosphatidylinositol (GPI) intermediate; human PIG-Fp is a functional homolog; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence ISS] [PMID 10793139]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA,IEA]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IC] [PMID 10793139]; GO_...
XM_018881852.1 -
Sugiyamaella lignohabitans -
NCBI
AA sequence:KEGG_Orthology:K07297" /note="Membrane protein involved in zinc ion homeostasis; member of the four-protein IZH family, expression induced by zinc deficiency; deletion reduces sensitivity to elevated zinc and shortens lag phase, overexpression reduces Zap1p activity; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA,IEA]; GO_component: GO...
XM_018880620.1 -
Sugiyamaella lignohabitans -
NCBI
CDS 1..1020 /gene="THI73" /locus_tag="AWJ20_3742" /note="Putative plasma membrane permease; proposed to be involved in carboxylic acid uptake and repressed by thiamine; substrate of Dbf2p/Mob1p kinase; transcription is altered if mitochondrial dysfunction occurs; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 16850348]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 - integral...
XM_018880768.1 -
Sugiyamaella lignohabitans -
NCBI
complex; required for efficient folding of proteins in the ER; null mutant displays induction of the unfolded protein response; homologous to worm Y57G7A.10/EMC-2, fly CG17556, human TTC35; GO_component: GO:0072546 - ER membrane protein complex [Evidence IDA] [PMID 19325107]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_function: GO:0003674 - molecular_function [Evidence ND]; GO_process: GO:0034975 - protein folding in endoplasmic reticulum [Evidence IGI] [PMID 19325107]" /codon_start...
XM_018880985.1 -
Sugiyamaella lignohabitans -
NCBI
gene="UBX7" /locus_tag="AWJ20_4039" /db_xref="GeneID:30036127" CDS 1..1827 /gene="UBX7" /locus_tag="AWJ20_4039" /note="UBX (ubiquitin regulatory X) domain-containing protein; interacts with Cdc48p; UBX7 has a paralog, UBX6, that arose from the whole genome duplication; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005635 - nuclear envelope [Evidence IDA] [PMID 14755638]; GO_function: GO:0003674 - molecular_function [Evidence ND]; GO_process: GO:0030435 - sporulation...
XM_018881088.1 -
Sugiyamaella lignohabitans -
NCBI
tag="AWJ20_1533" /db_xref="GeneID:30033346" CDS 1..1485 /gene="KRE5" /locus_tag="AWJ20_1533" /inference="similar to AA sequence:KEGG_Orthology:K11718" /note="Protein required for beta-1,6 glucan biosynthesis; mutations result in aberrant morphology and severe growth defects; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence TAS] [PMID 10601196]; GO_component: GO:0005788 - endoplasmic reticulum lumen [Evidence IEA]; GO_function: GO:0003980 - UDP-glucose:glycoprotein glucosyltransferase activity [Evidence IEA]; GO_function...
XM_018878423.1 -
Sugiyamaella lignohabitans -
NCBI
inference="similar to AA sequence:KEGG_Orthology:K14713" /note="Zinc transporter; localizes to the ER; null mutant is sensitive to calcofluor white, leads to zinc accumulation in cytosol; ortholog of the mouse KE4 and member of the ZIP (ZRT, IRT-like Protein) family; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 16760462]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016021 - integral...
XM_018880366.1 -
Sugiyamaella lignohabitans -
NCBI
Qualifiers source 1..705 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="VII" gene 705 /gene="MST27" /locus_tag="YGL051W" /db_xref="GeneID:852830" CDS 1..705 /gene="MST27" /locus_tag="YGL051W" /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic reticulum [PMID:12925749|PMID:26928762]" /experiment="EXISTENCE:direct assay:GO:0005794 Golgi apparatus [PMID:12925749]" /experiment="EXISTENCE:direct assay:GO:0016020 membrane [PMID:12925749]" /experiment="EXISTENCE:genetic interaction:GO:0006888 endoplasmic reticulum to Golgi...
NM_001180916.1 -
Saccharomyces cerevisiae S288C -
NCBI
chromosome="Unknown" /country="South Korea" /collection_date="Jan-2015" gene 207 /locus_tag="B9G98_01066" /db_xref="GeneID:36514815" CDS 1..207 /locus_tag="B9G98_01066" /codon_start=1 /product="hypothetical protein" /protein_id="XP_024663392.1" /db_xref="GeneID:36514815" /db_xref="GO:0005783" /db_xref="InterPro:IPR010580" /db_xref="PFAM:PF06624" /translation="MAPQTPAQRAANEKYARRELAKKGKRVAPTYKSKLDKKPARKIPFGYIAFFLFLILGTVFVEAIIGRA" ORIGIN // REFERENCE 1 (bases 1 to 207) AUTHORS Ahn,J.O. TITLE Genome sequencing of [Candida] sorbophila JOURNAL Unpublished REFERENCE 2 (bases 1 to 207) CONSRTM NCBI...
XM_024807624.1 -
Wickerhamiella sorbophila -
NCBI
that associates with endoplasmic reticulum-derived COPII-coated vesicles; GO_component: GO:0030134 - ER to Golgi transport vesicle [Evidence IDA] [PMID 11157978]; GO_component: GO:0005794 - Golgi apparatus [Evidence IEA]; GO_component: GO:0000139 - Golgi membrane [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 8862519]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA,IEA]; GO_component: GO...
XM_018878834.1 -
Sugiyamaella lignohabitans -
NCBI
sequence:KEGG_Orthology:K18932" /note="Palmitoyltransferase with autoacylation activity; required for palmitoylation of amino acid permeases containing a C-terminal Phe-Trp-Cys site; required for modification of Chs3p; member of the DHHC family of putative palmitoyltransferases; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 16647879]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO...
XM_018881096.1 -
Sugiyamaella lignohabitans -
NCBI
note="UDP-glycosyltransferase subunit of the GPI-GnT complex; UDP-GlcNAc-binding and catalytic subunit of the enzyme that mediates the first step in glycosylphosphatidylinositol (GPI) biosynthesis, mutations cause defects in transcription and in biogenesis of cell wall proteins; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IMP] [PMID 9079905]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0000506 - glycosylphosphatidylinositol-N- acetylglucosaminyltransferase (GPI-GnT)...
XM_018878691.1 -
Sugiyamaella lignohabitans -
NCBI
ucb@sanger.ac.uk; term=annotation;date=20181018;qualifier=removed_product=co nserved protein, unknown function;qualifier=added_product=protein transport protein use1, putative;qualifier=added_gene_name=use1;qualifier=added_li terature=pmid:12853481;qualifier=added_GO:0006890;qualifie r=added_GO:0005783;curatorName=ucb@sanger.ac.uk; ;query 322-322; ;query 299-321; ;query 1-298; tmhmm; query 1-323; pfam_scan;Pfam:PF09753.5; E()=2.8E-8;score=33.6;query 29-317;description=Use1; iprscan;InterPro:IPR019150 : Vesicle transport protein, Use1;Pfam:PF09753; score=2.9E-8;query 29-317;description=Vesicle...
XM_740208.1 -
Plasmodium chabaudi chabaudi -
NCBI
in chitin biosynthesis by regulation of Chs3p export from the ER; relocalizes from bud neck to ER upon DNA replication stress; GO_component: GO:0005935 - cellular bud neck [Evidence IDA] [PMID 22842922]; GO_component: GO:0005934 - cellular bud tip [Evidence IDA] [PMID 22842922]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 22842922]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IDA] [PMID 10366589]; GO_...
XM_018877857.1 -
Sugiyamaella lignohabitans -
NCBI
transamidase complex that adds GPIs to newly synthesized proteins; human PIG-S homolog; GO_component: GO:0042765 - GPI-anchor transamidase complex [Evidence IEA]; GO_component: GO:0042765 - GPI-anchor transamidase complex [Evidence IDA] [PMID 15939668]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 15075373]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of...
XM_018881939.1 -
Sugiyamaella lignohabitans -
NCBI
db_xref="taxon:796027" /chromosome="C" gene 2190 /gene="SLY41" /locus_tag="AWJ20_3998" /db_xref="GeneID:30036080" CDS 1..2190 /gene="SLY41" /locus_tag="AWJ20_3998" /inference="similar to AA sequence:KEGG_Orthology:K15283" /note="Protein involved in ER-to-Golgi transport; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 23613772]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence ISM]...
XM_018881042.1 -
Sugiyamaella lignohabitans -
NCBI
mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="II" gene 1377 /gene="ALG3" /locus_tag="YBL082C" /gene_synonym="RHK1" /db_xref="GeneID:852196" CDS 1..1377 /gene="ALG3" /locus_tag="YBL082C" /gene_synonym="RHK1" /EC_number="2.4.1.258" /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic reticulum [PMID:26928762]" /experiment="EXISTENCE:direct assay:GO:0006490 oligosaccharide-lipid intermediate biosynthetic process [PMID:11308030]" /experiment="EXISTENCE:direct assay:GO:0052925 dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase activity [PMID:11308030]" /...
Synonym: RHK1
NM_001178322.1 -
Saccharomyces cerevisiae S288C -
NCBI
BSD2" /locus_tag="AWJ20_651" /note="Heavy metal ion homeostasis protein; facilitates trafficking of Smf1p and Smf2p metal transporters to the vacuole where they are degraded, controls metal ion transport, prevents metal hyperaccumulation, functions in copper detoxification; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 9115231]; GO_component: GO:0000324 - fungal-type vacuole [Evidence IDA] [PMID 23708375]; GO_component: GO:0000329 - fungal-type vacuole membrane [Evidence IDA] [PMID 14988731]; GO_...
XM_018882603.1 -
Sugiyamaella lignohabitans -
NCBI
similar to AA sequence:KEGG_Orthology:K00637" /note="Acyl-CoA:sterol acyltransferase; endoplasmic reticulum enzyme that contributes the major sterol esterification activity in the presence of oxygen; ARE2 has a paralog, ARE1, that arose from the whole genome duplication; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 10672016]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016021 -...
XM_018878141.1 -
Sugiyamaella lignohabitans -
NCBI
inference="similar to AA sequence:KEGG_Orthology:K00511" /note="Squalene epoxidase; catalyzes the epoxidation of squalene to 2,3-oxidosqualene; plays an essential role in the ergosterol-biosynthesis pathway and is the specific target of the antifungal drug terbinafine; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 9450962]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA,IEA]; GO_component: GO:0043231 -...
XM_018878568.1 -
Sugiyamaella lignohabitans -
NCBI
Data Export:
Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.
Debug Info:
Redirect URI : http://ggrna.dbcls.jp/GO%3a0005783
lang : en |
div : |
spe : |
query_string : GO:0005783 |
format : html |
download :
0.000 | 0.000 | search_start;
0.079 | 0.079 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:GO%5c%3a0005783)%7C(nt:GO%5c%3a0005783)%7C(aa:GO%5c%3a0005783))?to=0&format=json
0.151 | 0.072 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:GO%5c%3a0005783)%7C(nt:GO%5c%3a0005783)%7C(aa:GO%5c%3a0005783))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.156 | 0.005 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]