LOCUS       XM_018878834             501 bp    mRNA    linear   PLN 07-JAN-2024
DEFINITION  Sugiyamaella lignohabitans Emp24p (EMP24), partial mRNA.
ACCESSION   XM_018878834
VERSION     XM_018878834.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Trichomonascaceae;
            Sugiyamaella.
REFERENCE   1  (bases 1 to 501)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 501)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 501)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_031672).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..501
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="mRNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Candida
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="A"
     gene            <1..>501
                     /gene="EMP24"
                     /locus_tag="AWJ20_192"
                     /db_xref="GeneID:30033774"
     CDS             1..501
                     /gene="EMP24"
                     /locus_tag="AWJ20_192"
                     /note="Component of the p24 complex; role in misfolded
                     protein quality control; binds to GPI anchor proteins and
                     mediates their efficient transport from the ER to the
                     Golgi; integral membrane protein that associates with
                     endoplasmic reticulum-derived COPII-coated vesicles;
                     GO_component: GO:0030134 - ER to Golgi transport vesicle
                     [Evidence IDA] [PMID 11157978]; GO_component: GO:0005794 -
                     Golgi apparatus [Evidence IEA]; GO_component: GO:0000139 -
                     Golgi membrane [Evidence IEA]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     8862519]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISS] [PMID 8862519]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0006888 -
                     ER to Golgi vesicle-mediated transport [Evidence IPI]
                     [PMID 11157978]; GO_process: GO:0006888 - ER to Golgi
                     vesicle-mediated transport [Evidence IMP] [PMID 8862519];
                     GO_process: GO:0006621 - protein retention in ER lumen
                     [Evidence IMP] [PMID 8862519]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA,IEA]; GO_process: GO:0016050 -
                     vesicle organization [Evidence IGI,IMP] [PMID 8862519];
                     GO_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Emp24p"
                     /protein_id="XP_018734442.1"
                     /db_xref="GeneID:30033774"
                     /translation="

MRKGDQLAISFQVGDRDPSSSNQLEVDFWITDPHKNQIRSLHRVADGDASVEITESGRYEYCFSNEFSHVGTKDVTFHIHGIVYVDNDNPSPDSLDSQVKILSRLVQEVKNEQGYLVIRERTHRNTAESTNSRVKWWSLFQIIVVAVNSLFQIYYLKRFFEVKTNV"

     misc_feature    1..483
                     /gene="EMP24"
                     /locus_tag="AWJ20_192"
                     /note="emp24/gp25L/p24 family/GOLD; Region: EMP24_GP25L;
                     pfam01105"
                     /db_xref="CDD:426051"
ORIGIN      

atgcgaaagggcgaccagctggccatttcgttccaggtcggtgaccgagacccttcgtcgtcgaatcaattggaggttgatttctggatcactgatccccacaaaaaccagatccggtctcttcacagagtggctgatggagatgcttcagtcgagatcactgaaagtggtcgctacgagtactgtttctccaacgagttctctcacgttggcaccaaagacgtcacattccacatccacggcattgtctatgtagacaacgacaacccatcaccagactcactcgacagccaagtcaagatcctcagtcgtcttgttcaagaagtcaagaacgagcaaggctacctcgtgatccgcgagcgaacccaccgtaacacagccgaatccaccaactcgcgtgtcaagtggtggagtctgttccaaatcattgtcgtcgccgtcaacagtctgttccagatctactacctcaagcggttttttgaggtcaagaccaatgtataa

//