2024-05-04 02:25:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_018879293 837 bp mRNA linear PLN 07-JAN-2024 DEFINITION Sugiyamaella lignohabitans Erj5p (ERJ5), partial mRNA. ACCESSION XM_018879293 VERSION XM_018879293.1 DBLINK BioProject: PRJNA342695 BioSample: SAMN04417247 KEYWORDS RefSeq. SOURCE Sugiyamaella lignohabitans ORGANISM Sugiyamaella lignohabitans Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Trichomonascaceae; Sugiyamaella. REFERENCE 1 (bases 1 to 837) AUTHORS Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M., Marx,H. and Mattanovich,D. TITLE Complete genome sequence and transcriptome regulation of the pentose utilising yeast Sugiyamaella lignohabitans JOURNAL Unpublished REFERENCE 2 (bases 1 to 837) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (04-JAN-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 837) AUTHORS Peymann,A. and Graf,A. TITLE Direct Submission JOURNAL Submitted (18-FEB-2016) Department of Biotechnology, University of Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna 1190, Austria COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_031674). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..837 /organism="Sugiyamaella lignohabitans" /mol_type="mRNA" /strain="CBS 10342" /type_material="culture from holotype of Candida lignohabitans" /db_xref="taxon:796027" /chromosome="B" gene <1..>837 /gene="ERJ5" /locus_tag="AWJ20_2354" /db_xref="GeneID:30034256" CDS 1..837 /gene="ERJ5" /locus_tag="AWJ20_2354" /note="Type I membrane protein with a J domain; required to preserve the folding capacity of the endoplasmic reticulum; loss of the non-essential ERJ5 gene leads to a constitutively induced unfolded protein response; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 17157937]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016020 - membrane [Evidence IEA]; GO_function: GO:0003674 - molecular_function [Evidence ND]; GO_process: GO:0006457 - protein folding [Evidence IMP] [PMID 17157937]" /codon_start=1 /product="Erj5p" /protein_id="XP_018737224.1" /db_xref="GeneID:30034256" /translation="
MLVKYQLLISLLFTSLIGFVAAWSDQDLEIFALREQVEKDLGKGATFYDWLDVPQYAKDEQIAKAYRKLSRQLHPDKNSHRSSTEKYTRLSLIVNILRSESRERYDFFLSKGFPRWKGTGYYYNRYRPGLGTVLVFLYLFISGAQYLLMKISSDRDRAHMSNVIDEAKRLAWSGSTTPGVNMSSKRRVTLPNGKIFTVYPSGDVFIVDHDVEFHLNLDDIKSPTWKDTILYKLPIWIRALITGQQAEFNEPEGHKLSDPEPPKKKTPRPATKVAGRRK"
misc_feature 136..318 /gene="ERJ5" /locus_tag="AWJ20_2354" /note="DnaJ domain; Region: DnaJ; pfam00226" /db_xref="CDD:395170" misc_feature order(220..228,250..252,259..264,271..273) /gene="ERJ5" /locus_tag="AWJ20_2354" /note="HSP70 interaction site [polypeptide binding]; other site" /db_xref="CDD:99751" ORIGIN
atgctggtgaaatatcagttattgatctcgctgctatttacgtccttgataggatttgtggctgcctggtcggaccaggacctggagatctttgctcttagggaacaggttgaaaaagatcttggaaaaggagctactttctacgactggctagacgtgcctcaatatgccaaggatgaacagattgccaaggcatatagaaagctttcgagacagcttcatcctgataagaacagccatcgtagttcgacagagaaatatactcgtttgagtttgatagttaatatccttcggtcagagtctcgtgagagatacgactttttcctttctaagggattccccagatggaagggaactggatactattataaccggtacagacccggtcttggaactgtgctcgtatttttatatctgttcatcagtggagcgcaatatctgctgatgaagatttcatcagatagagaccgcgctcacatgtccaatgtgattgatgaggccaaacgactagcatggtctggatctaccactcctggggtcaacatgagctcgaaacgccgtgtcactcttcccaatggcaagatctttactgtctacccgtcaggagacgtttttatcgttgaccacgacgtcgagttccacctcaacctggacgacattaaatcacccacttggaaggacactatcctctacaaactgcccatctggattcgagctcttattaccggccaacaggctgagttcaacgaaccagagggccataaactctcggaccctgaaccacccaagaaaaagactcctcgtccggccactaaggtcgccggccgccgtaaatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]