GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-04 02:25:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_018879293             837 bp    mRNA    linear   PLN 07-JAN-2024
DEFINITION  Sugiyamaella lignohabitans Erj5p (ERJ5), partial mRNA.
ACCESSION   XM_018879293
VERSION     XM_018879293.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Trichomonascaceae;
            Sugiyamaella.
REFERENCE   1  (bases 1 to 837)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 837)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 837)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_031674).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..837
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="mRNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Candida
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="B"
     gene            <1..>837
                     /gene="ERJ5"
                     /locus_tag="AWJ20_2354"
                     /db_xref="GeneID:30034256"
     CDS             1..837
                     /gene="ERJ5"
                     /locus_tag="AWJ20_2354"
                     /note="Type I membrane protein with a J domain; required
                     to preserve the folding capacity of the endoplasmic
                     reticulum; loss of the non-essential ERJ5 gene leads to a
                     constitutively induced unfolded protein response;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 17157937];
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0006457 - protein folding [Evidence IMP] [PMID
                     17157937]"
                     /codon_start=1
                     /product="Erj5p"
                     /protein_id="XP_018737224.1"
                     /db_xref="GeneID:30034256"
                     /translation="
MLVKYQLLISLLFTSLIGFVAAWSDQDLEIFALREQVEKDLGKGATFYDWLDVPQYAKDEQIAKAYRKLSRQLHPDKNSHRSSTEKYTRLSLIVNILRSESRERYDFFLSKGFPRWKGTGYYYNRYRPGLGTVLVFLYLFISGAQYLLMKISSDRDRAHMSNVIDEAKRLAWSGSTTPGVNMSSKRRVTLPNGKIFTVYPSGDVFIVDHDVEFHLNLDDIKSPTWKDTILYKLPIWIRALITGQQAEFNEPEGHKLSDPEPPKKKTPRPATKVAGRRK"
     misc_feature    136..318
                     /gene="ERJ5"
                     /locus_tag="AWJ20_2354"
                     /note="DnaJ domain; Region: DnaJ; pfam00226"
                     /db_xref="CDD:395170"
     misc_feature    order(220..228,250..252,259..264,271..273)
                     /gene="ERJ5"
                     /locus_tag="AWJ20_2354"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
ORIGIN      
atgctggtgaaatatcagttattgatctcgctgctatttacgtccttgataggatttgtggctgcctggtcggaccaggacctggagatctttgctcttagggaacaggttgaaaaagatcttggaaaaggagctactttctacgactggctagacgtgcctcaatatgccaaggatgaacagattgccaaggcatatagaaagctttcgagacagcttcatcctgataagaacagccatcgtagttcgacagagaaatatactcgtttgagtttgatagttaatatccttcggtcagagtctcgtgagagatacgactttttcctttctaagggattccccagatggaagggaactggatactattataaccggtacagacccggtcttggaactgtgctcgtatttttatatctgttcatcagtggagcgcaatatctgctgatgaagatttcatcagatagagaccgcgctcacatgtccaatgtgattgatgaggccaaacgactagcatggtctggatctaccactcctggggtcaacatgagctcgaaacgccgtgtcactcttcccaatggcaagatctttactgtctacccgtcaggagacgtttttatcgttgaccacgacgtcgagttccacctcaacctggacgacattaaatcacccacttggaaggacactatcctctacaaactgcccatctggattcgagctcttattaccggccaacaggctgagttcaacgaaccagagggccataaactctcggaccctgaaccacccaagaaaaagactcctcgtccggccactaaggtcgccggccgccgtaaatag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]