GGRNA | Results

Matches are highlighted with green background. Overlapping matches are dark colored.

Metarhizium brunneum uncharacterized protein (G6M90_00g096120), partial mRNA. (204 bp)

geo_loc_name="USA: Florida" /collection_date="29-Sep-1993" gene 204 /locus_tag="G6M90_00g096120" /db_xref="GeneID:90968155" CDS 1..204 /locus_tag="G6M90_00g096120" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_065987771.1" /db_xref="GeneID:90968155" /db_xref="GO:0005783" /db_xref="InterPro:IPR010580" /db_xref="PFAM:PF06624" /translation="MAQTLEQRRRNAKFAKEQEARMGKSDDQIKKRAKETPKSPISPVWIGVLGFIVFGGLLFEALSRMFA" misc_feature 4..180 /locus_tag="G6M90_00g096120" /note="Ribosome associated membrane protein RAMP4; Region: RAMP4; pfam06624" /db_xref="CDD:461965" ORIGIN // REFERENCE 1...

XM_066131504.1 - Metarhizium brunneum - NCBI

Sugiyamaella lignohabitans Rer2p (RER2), partial mRNA. (939 bp)

locus_tag="AWJ20_395" /inference="similar to AA sequence:KEGG_Orthology:K11778" /note="Cis-prenyltransferase involved in dolichol synthesis; major enzyme of polyprenol synthesis in both the endoplasmic reticulum (ER) and in lipid droplets; participates in ER protein sorting; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11442630]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 24868093]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 9858571]; GO_component: GO...

XM_018880991.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans sphingosine N-acyltransferase LAG1 (LAG1), partial mRNA. (1200 bp)

CERS2, a tumor metastasis suppressor gene whose silencing enahnces invasion/metastasis of prostate cancer cells; LAG1 has a paralog, LAC1, that arose from the whole genome duplication; GO_component: GO:0061576 - acyl-CoA ceramide synthase complex [Evidence IDA] [PMID 15692566]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 22842922]; GO_component...

XM_018881631.1 - Sugiyamaella lignohabitans - NCBI

Metarhizium brunneum SRP-independent targeting protein 3 (PHO88), partial mRNA. (579 bp)

locus_tag="G6M90_00g031740" /old_locus_tag="MBR_06643" /db_xref="GeneID:26243913" CDS 1..579 /gene="PHO88" /locus_tag="G6M90_00g031740" /old_locus_tag="MBR_06643" /codon_start=1 /product="SRP-independent targeting protein 3" /protein_id="XP_014543112.1" /db_xref="GeneID:26243913" /db_xref="GO:0005783" /db_xref="GO:0045047,GO" /db_xref="InterPro:IPR012098" /db_xref="PFAM:PF10032" /translation="MAGLNPQITNLVIMLGMMQVSKRIPFDDPNVLNTVRAVYLGSNVLIALLYLYIGSQINKKKDLTTLKYVEPPPMGSTEEGKLVTTTIQAYDKDQLRALFRGQMMGIAIMGFMHLYMKYTNPLLIQSILPVKSALESNLVKIHIYGQPASGDLKRPFKQAAGFMSAMQQGQAQSDKKAVEAAEKSGRGGAKEE" misc_...

XM_014687626.1 - Metarhizium brunneum - NCBI

Sugiyamaella lignohabitans sphingosine N-acyltransferase LAG1 (LAG1), partial mRNA. (1221 bp)

XM_018878309.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans Erj5p (ERJ5), partial mRNA. (837 bp)

CDS 1..837 /gene="ERJ5" /locus_tag="AWJ20_2354" /note="Type I membrane protein with a J domain; required to preserve the folding capacity of the endoplasmic reticulum; loss of the non-essential ERJ5 gene leads to a constitutively induced unfolded protein response; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 17157937]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 -...

XM_018879293.1 - Sugiyamaella lignohabitans - NCBI

Metarhizium brunneum uncharacterized protein (G6M90_00g058850), partial mRNA. (609 bp)

date="29-Sep-1993" gene 609 /locus_tag="G6M90_00g058850" /old_locus_tag="MBR_05601" /db_xref="GeneID:26242871" CDS 1..609 /locus_tag="G6M90_00g058850" /old_locus_tag="MBR_05601" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_014544459.1" /db_xref="GeneID:26242871" /db_xref="GO:0005783" /db_xref="GO:0006886,GO" /db_xref="GO:0016021,GO" /db_xref="InterPro:IPR008417" /db_xref="PFAM:PF05529" /translation="...

XM_014688973.1 - Metarhizium brunneum - NCBI

Sugiyamaella lignohabitans Orm1p (ORM1), partial mRNA. (549 bp)

protein response; Orm1p and Orm2p together control membrane biogenesis by coordinating lipid homeostasis with protein quality control; ORM1 has a paralog, ORM2, that arose from the whole genome duplication; GO_component: GO:0035339 - SPOTS complex [Evidence IDA] [PMID 20182505]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 20182505]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018882133.1 - Sugiyamaella lignohabitans - NCBI

Cladosporium halotolerans uncharacterized protein (WHR41_08618), mRNA. (839 bp)

lat_lon="36.719250 N 3.727528 W" /collection_date="2017-03-05/2017-03-25" gene 1..839 /locus_tag="WHR41_08618" /db_xref="GeneID:96010060" CDS 99..677 /locus_tag="WHR41_08618" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_069225829.1" /db_xref="GeneID:96010060" /db_xref="GO:0005783|GO" /db_xref="GO:0045047" /db_xref="InterPro:IPR012098" /db_xref="PFAM:PF10032" /translation="MNPQITNLVIILVMMQVSKKIPFEDPNVLTGVRALYIISNVLIAAIYFYVKMQIDKKRDMTVLKYVEPAPMGSTEEPKAVTTTVHAYDQQQLRNLFKSQVMGVGMMGVMHLYFHYTNPLLIQSIIPFKGALEGNLVKVHVFGQPAAGELKRPWKAAGGFGGMMGGAGAGDIKTDKKSIEAAERAGRGGAKEE" misc_...

XM_069377222.1 - Cladosporium halotolerans - NCBI

Sugiyamaella lignohabitans Yet3p (YET3), partial mRNA. (591 bp)

YET3" /locus_tag="AWJ20_835" /inference="similar to AA sequence:KEGG_Orthology:K14009" /note="hypothetical protein; YET3 null mutant decreases the level of secreted invertase; homolog of human BAP31 protein; protein abundance increases in response to DNA replication stress; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 20378542]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018882803.1 - Sugiyamaella lignohabitans - NCBI

Metarhizium brunneum Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase (alg-3), partial mRNA. (1299 bp)

old_locus_tag="MBR_00817" /db_xref="GeneID:26238087" CDS 1..1299 /gene="alg-3" /locus_tag="G6M90_00g018970" /old_locus_tag="MBR_00817" /codon_start=1 /product="Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase" /protein_id="XP_014548643.1" /db_xref="GeneID:26238087" /db_xref="GO:0005783,GO" /db_xref="GO:0016021,GO" /db_xref="GO:0016758" /db_xref="InterPro:IPR007873" /db_xref="PFAM:PF05208" /translation="...

XM_014693157.1 - Metarhizium brunneum - NCBI

Metarhizium brunneum Calnexin (CALX), partial mRNA. (1692 bp)

old_locus_tag="MBR_03329" /db_xref="GeneID:26240599" CDS 1..1692 /gene="CALX" /locus_tag="G6M90_00g101690" /old_locus_tag="MBR_03329" /codon_start=1 /product="Calnexin" /protein_id="XP_014546176.1" /db_xref="GeneID:26240599" /db_xref="GO:0005509,GO" /db_xref="GO:0005515" /db_xref="GO:0005783,GO" /db_xref="GO:0006457,GO" /db_xref="GO:0051082,GO" /db_xref="InterPro:IPR001580" /db_xref="PFAM:PF00262" /translation="...

XM_014690690.1 - Metarhizium brunneum - NCBI

Cladosporium halotolerans uncharacterized protein (WHR41_05382), mRNA. (1217 bp)

lat_lon="36.719250 N 3.727528 W" /collection_date="2017-03-05/2017-03-25" gene 1..1217 /locus_tag="WHR41_05382" /db_xref="GeneID:96006825" CDS 138..908 /locus_tag="WHR41_05382" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_069229453.1" /db_xref="GeneID:96006825" /db_xref="GO:0005783|GO" /db_xref="GO:0006458" /db_xref="InterPro:IPR019623" /db_xref="PFAM:PF10681" /translation="...

XM_069373987.1 - Cladosporium halotolerans - NCBI

Metarhizium brunneum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 (ribo-1), partial mRNA. (1461 bp)

GeneID:26240606" CDS 1..1461 /gene="ribo-1" /locus_tag="G6M90_00g101620" /old_locus_tag="MBR_03336" /codon_start=1 /product="Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1" /protein_id="XP_014546183.1" /db_xref="GeneID:26240606" /db_xref="GO:0004579,GO" /db_xref="GO:0005783,GO" /db_xref="GO:0006486" /db_xref="GO:0016021,GO" /db_xref="InterPro:IPR007676" /db_xref="PFAM:PF04597" /translation="...

XM_014690697.1 - Metarhizium brunneum - NCBI

Metarhizium brunneum Endoplasmic reticulum oxidoreductin-1 (ero-1), partial mRNA. (1794 bp)

old_locus_tag="MBR_00041" /db_xref="GeneID:26237311" CDS 1..1794 /gene="ero-1" /locus_tag="G6M90_00g027200" /old_locus_tag="MBR_00041" /codon_start=1 /product="Endoplasmic reticulum oxidoreductin-1" /protein_id="XP_014547867.1" /db_xref="GeneID:26237311" /db_xref="GO:0003756" /db_xref="GO:0005783,GO" /db_xref="GO:0016671,GO" /db_xref="GO:0055114,GO" /db_xref="InterPro:IPR007266" /db_xref="PFAM:PF04137" /translation="...

XM_014692381.1 - Metarhizium brunneum - NCBI

Metarhizium brunneum Protein disulfide-isomerase (PDI_1), partial mRNA. (1542 bp)

PDI_1" /locus_tag="G6M90_00g097390" /old_locus_tag="MBR_03755" /db_xref="GeneID:26241025" CDS 1..1542 /gene="PDI_1" /locus_tag="G6M90_00g097390" /old_locus_tag="MBR_03755" /codon_start=1 /product="Protein disulfide-isomerase" /protein_id="XP_014546602.1" /db_xref="GeneID:26241025" /db_xref="GO:0005783" /db_xref="GO:0016853,GO" /db_xref="GO:0045454,GO" /db_xref="InterPro:IPR005788" /db_xref="InterPro:IPR005792" /db_xref="InterPro:IPR013766" /db_xref="PFAM:PF00085" /db_xref="PFAM:PF13848" /db_xref="TIGRFAM:TIGR01126" /db_xref="TIGRFAM:TIGR01130" /translation="...

XM_014691116.1 - Metarhizium brunneum - NCBI

Sugiyamaella lignohabitans putative ATPase ECM3 (ECM3), partial mRNA. (1605 bp)

in response to treatment with 8-methoxypsoralen and UVA irradiation; relocalizes from ER to cytoplasm upon DNA replication stress; ECM3 has a paralog, YNL095C, that arose from the whole genome duplication; GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID 22842922]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 22842922]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018881650.1 - Sugiyamaella lignohabitans - NCBI

Debaryomyces fabryi Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase (AC631_01322), partial mRNA. (1446 bp)

collected_by="C.P. Kurtzman" gene 1446 /locus_tag="AC631_01322" /db_xref="GeneID:26838331" CDS 1..1446 /locus_tag="AC631_01322" /codon_start=1 /product="Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase" /protein_id="XP_015469059.1" /db_xref="GeneID:26838331" /db_xref="GO:0005783" /db_xref="GO:0016021" /db_xref="GO:0016758" /db_xref="InterPro:IPR007873" /db_xref="PFAM:PF05208" /translation="...

XM_015610152.1 - Debaryomyces fabryi - NCBI

Cladosporium halotolerans uncharacterized protein (WHR41_07526), mRNA. (1729 bp)

W" /collection_date="2017-03-05/2017-03-25" gene 1..1729 /locus_tag="WHR41_07526" /db_xref="GeneID:96008968" CDS 72..1415 /locus_tag="WHR41_07526" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_069226791.1" /db_xref="GeneID:96008968" /db_xref="GO:0005509|GO" /db_xref="GO:0005783|GO" /db_xref="GO:0032469" /db_xref="InterPro:IPR012879" /db_xref="PFAM:PF07946" /translation="...

XM_069376130.1 - Cladosporium halotolerans - NCBI

Sugiyamaella lignohabitans Gtb1p (GTB1), partial mRNA. (1614 bp)

sequence:KEGG_Orthology:K08288" /note="Glucosidase II beta subunit, forms a complex with alpha subunit Rot2p; involved in removal of two glucose residues from N-linked glycans during glycoprotein biogenesis in the ER; relocalizes from ER to cytoplasm upon DNA replication stress; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 22842922]; GO_component: GO:0005788 - endoplasmic reticulum lumen [Evidence IDA] [PMID 16373354]; GO...

XM_018879613.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans Say1p (SAY1), partial mRNA. (918 bp)

component of the sterol acetylation/deacetylation cycle along with Atf2p; active both in the endoplasmic reticulum (ER) and in lipid droplets; integral membrane protein with active site in the ER lumen; green fluorescent protein (GFP)-fusion protein localizes to the ER; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 24868093]; GO_component: GO:0005788 - endoplasmic reticulum lumen [Evidence IDA] [PMID 18034159]; GO_component:...

XM_018880969.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans Say1p (SAY1), partial mRNA. (987 bp)

XM_018879924.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans peptidylprolyl isomerase family protein CPR5 (CPR5), partial mRNA. (645 bp)

trans isomerization of peptide bonds N-terminal to proline residues; transcriptionally induced in response to unfolded proteins in the ER; CPR5 has a paralog, CPR2, that arose from the whole genome duplication; GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 8377189]; GO_component: GO:0005788 - endoplasmic reticulum lumen [Evidence IEA]; GO_function: GO...

XM_018880661.1 - Sugiyamaella lignohabitans - NCBI

Metarhizium brunneum Very-long-chain 3-oxoacyl-CoA reductase (MKAR), partial mRNA. (1041 bp)

tag="G6M90_00g046430" /old_locus_tag="MBR_04840" /db_xref="GeneID:26242110" CDS 1..1041 /gene="MKAR" /locus_tag="G6M90_00g046430" /old_locus_tag="MBR_04840" /codon_start=1 /product="Very-long-chain 3-oxoacyl-CoA reductase" /protein_id="XP_014544769.1" /db_xref="GeneID:26242110" /db_xref="GO:0005783,GO" /db_xref="GO:0016491,GO" /db_xref="GO:0030497,GO" /db_xref="GO:0045703" /db_xref="InterPro:IPR002347" /db_xref="PFAM:PF00106" /translation="...

XM_014689283.1 - Metarhizium brunneum - NCBI

Sugiyamaella lignohabitans Sec20p (SEC20), partial mRNA. (1059 bp)

in the ER; interacts with the Dsl1p complex through Tip20p; GO_component: GO:0031201 - SNARE complex [Evidence IDA] [PMID 12853481]; GO_component: GO:0031201 - SNARE complex [Evidence IDA] [PMID 12893879]; GO_component: GO:0031201 - SNARE complex [Evidence IDA] [PMID 9214619]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 8334998]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018881312.1 - Sugiyamaella lignohabitans - NCBI

Cladosporium halotolerans uncharacterized protein (WHR41_01106), mRNA. (2194 bp)

lat_lon="36.719250 N 3.727528 W" /collection_date="2017-03-05/2017-03-25" gene 1..2194 /locus_tag="WHR41_01106" /db_xref="GeneID:96002550" CDS 332..2152 /locus_tag="WHR41_01106" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_069233021.1" /db_xref="GeneID:96002550" /db_xref="GO:0005783|GO" /db_xref="GO:0015035|GO" /db_xref="GO:0016972|GO" /db_xref="GO:0034975|GO" /db_xref="GO:0071949" /db_xref="InterPro:IPR007266" /db_xref="PFAM:PF04137" /translation="...

XM_069369712.1 - Cladosporium halotolerans - NCBI

Sugiyamaella lignohabitans Wbp1p (WBP1), partial mRNA. (1368 bp)

GeneID:30035203" CDS 1..1368 /gene="WBP1" /locus_tag="AWJ20_3206" /inference="similar to AA sequence:KEGG_Orthology:K12670" /note="Beta subunit of the oligosaccharyl transferase glycoprotein complex; required for N-linked glycosylation of proteins in the endoplasmic reticulum; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 12860997]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 1724755]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA,IEA]; GO_component: GO...

XM_018880214.1 - Sugiyamaella lignohabitans - NCBI

Cladosporium halotolerans uncharacterized protein (WHR41_05028), mRNA. (2149 bp)

W" /collection_date="2017-03-05/2017-03-25" gene 1..2149 /locus_tag="WHR41_05028" /db_xref="GeneID:96006471" CDS 165..1913 /locus_tag="WHR41_05028" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_069229044.1" /db_xref="GeneID:96006471" /db_xref="GO:0005509|GO" /db_xref="GO:0005783|GO" /db_xref="GO:0006457|GO" /db_xref="GO:0051082" /db_xref="InterPro:IPR001580" /db_xref="PFAM:PF00262" /translation="...

XM_069373633.1 - Cladosporium halotolerans - NCBI

Sugiyamaella lignohabitans Zn(2+) transporter ZRG17 (ZRG17), partial mRNA. (2244 bp)

transporter; part of a heterodimeric transporter with Msc2p that transfers zinc from the cytosol to the ER lumen; member of the cation diffusion facilitator family of efflux pumps; zinc-regulated directly through Zap1p; transcription induced under conditions of zinc deficiency; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 15961382]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018882884.1 - Sugiyamaella lignohabitans - NCBI

Metarhizium brunneum RAD50-interacting protein 1 (RINT1), partial mRNA. (2391 bp)

RINT1" /locus_tag="G6M90_00g043620" /old_locus_tag="MBR_02989" /db_xref="GeneID:26240259" CDS 1..2391 /gene="RINT1" /locus_tag="G6M90_00g043620" /old_locus_tag="MBR_02989" /codon_start=1 /product="RAD50-interacting protein 1" /protein_id="XP_014547696.1" /db_xref="GeneID:26240259" /db_xref="GO:0005783,GO" /db_xref="GO:0048193" /db_xref="InterPro:IPR007528" /db_xref="PFAM:PF04437" /translation="...

XM_014692210.1 - Metarhizium brunneum - NCBI

Fulvia fulva uncharacterized protein (CLAFUR5_05020), partial mRNA. (210 bp)

taxon:5499" /chromosome="4" /geo_loc_name="France" /collection_date="1979" gene 210 /locus_tag="CLAFUR5_05020" /db_xref="GeneID:71984898" CDS 1..210 /locus_tag="CLAFUR5_05020" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_047760120.1" /db_xref="GeneID:71984898" /db_xref="GO:0005783" /db_xref="InterPro:IPR010580" /db_xref="PFAM:PF06624" /translation="MAQTPQQRKANAAFAKKQEAKMGKPESSLPVKKEKKEKPPISPFWVYTLIFVVCGGLIFELLRMIAGYF" misc_feature 4..186 /locus_tag="CLAFUR5_05020" /note="Ribosome associated membrane protein RAMP4; Region: RAMP4; pfam06624" /db_xref="CDD:461965" ORIGIN //...

XM_047904168.1 - Fulvia fulva - NCBI

Sugiyamaella lignohabitans Rtn1p (RTN1), partial mRNA. (1065 bp)

transfer between the ER and mitochondria; RTN1 has a paralog, RTN2, that arose from the whole genome duplication; GO_component: GO:0005794 - Golgi apparatus [Evidence IDA] [PMID 16002643]; GO_component: GO:0032541 - cortical endoplasmic reticulum [Evidence IDA] [PMID 16624861]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 16002643]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018881454.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans phosphatidate cytidylyltransferase (CDS1), partial mRNA. (1284 bp)

; an enzyme that catalyzes that conversion of CTP + phosphate into diphosphate + CDP-diaclglyerol, a critical step in the synthesis of all major yeast phospholipids; GO_component: GO:0070319 - Golgi to plasma membrane transport vesicle [Evidence IDA] [PMID 2163397]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 23623749]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 8557688]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018878350.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans sphinganine kinase LCB4 (LCB4), partial mRNA. (1149 bp)

component: GO:0005794 - Golgi apparatus [Evidence IEA]; GO_component: GO:0005794 - Golgi apparatus [Evidence IDA] [PMID 12459470]; GO_component: GO:0000139 - Golgi membrane [Evidence IEA]; GO_component: GO:0032541 - cortical endoplasmic reticulum [Evidence IDA] [PMID 17686782]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 12493772]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 16141212]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018880669.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans Ale1p (ALE1), partial mRNA. (1392 bp)

similar to AA sequence:KEGG_Orthology:K13519" /note="Broad-specificity lysophospholipid acyltransferase; part of MBOAT family of membrane-bound O-acyltransferases; key component of Lands cycle; may have role in fatty acid exchange at sn-2 position of mature glycerophospholipids; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 17890783]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018879510.1 - Sugiyamaella lignohabitans - NCBI

Metarhizium brunneum Protein disulfide-isomerase erp38 (erp38), partial mRNA. (1119 bp)

locus_tag="G6M90_00g107880" /old_locus_tag="MBR_06173" /db_xref="GeneID:26243443" CDS 1..1119 /gene="erp38" /locus_tag="G6M90_00g107880" /old_locus_tag="MBR_06173" /codon_start=1 /product="Protein disulfide-isomerase erp38" /protein_id="XP_014544056.1" /db_xref="GeneID:26243443" /db_xref="GO:0005783" /db_xref="GO:0016853,GO" /db_xref="GO:0045454,GO" /db_xref="InterPro:IPR005788" /db_xref="InterPro:IPR011679" /db_xref="InterPro:IPR013766" /db_xref="PFAM:PF00085" /db_xref="PFAM:PF07749" /db_xref="TIGRFAM:TIGR01126" /translation="...

XM_014688570.1 - Metarhizium brunneum - NCBI

Cladosporium halotolerans uncharacterized protein (WHR41_06729), mRNA. (1364 bp)

W" /collection_date="2017-03-05/2017-03-25" gene 1..1364 /locus_tag="WHR41_06729" /db_xref="GeneID:96008172" CDS 51..1136 /locus_tag="WHR41_06729" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_069227378.1" /db_xref="CDD:cd02998" /db_xref="GeneID:96008172" /db_xref="GO:0005783" /db_xref="InterPro:IPR011679" /db_xref="InterPro:IPR013766" /db_xref="PFAM:PF00085" /db_xref="PFAM:PF07749" /translation="...

XM_069375334.1 - Cladosporium halotolerans - NCBI

Plasmodium chabaudi chabaudi signal peptidase complex subunit 2, putative (PCHAS_1218500), partial mRNA. (555 bp)

added_literature=pmid:18054093;curatorN ame=ucb@sanger.ac.uk; term=annotation;date=20180829;qualifier=removed_product=si gnal peptidase complex subunit SPC2, putative;qualifier=added_product=signal peptidase complex subunit 2, putative;qualifier=added_literature=pmid:30127496;qualifie r=added_GO:0005783;qualifier=added_GO:0045047;qualifier=ad ded_GO:0005787;curatorName=ucb@sanger.ac.uk; pfam_scan;Pfam:PF06703.7; E()=3.0E-9;score=36.7;query 26-171;description=SPC25; iprscan;InterPro:IPR009582 : Microsomal signal peptidase 25 kDa subunit;Pfam:PF06703; score=4.0E-9;query 26-171;description=Signal...

XM_016798883.1 - Plasmodium chabaudi chabaudi - NCBI

Fulvia fulva SRP-independent targeting protein 3 (CLAFUR5_06707), partial mRNA. (579 bp)

chromosome="6" /geo_loc_name="France" /collection_date="1979" gene 579 /locus_tag="CLAFUR5_06707" /db_xref="GeneID:71986585" CDS 1..579 /locus_tag="CLAFUR5_06707" /codon_start=1 /product="SRP-independent targeting protein 3" /protein_id="XP_047763144.1" /db_xref="GeneID:71986585" /db_xref="GO:0005783|GO" /db_xref="GO:0045047" /db_xref="InterPro:IPR012098" /db_xref="PFAM:PF10032" /translation="MVNPQITNLVIILVMMQASKKIPFDDPNVLNGVRALYVVSNIIIAGIYIYVQQTINKKRDMTVLKYVEPAPMGSTEEPKAVTTTVHAYDTTQLKGLFKSQLMGVGMMAVMHLYFKYTNPLLIQSIIPLKGAFEGNLVKVHLFGQAATGDLKRPWKANAGMAGMLGGQQGEVKTDKKSIEAAEKAGRGGVKEE" misc_...

XM_047905855.1 - Fulvia fulva - NCBI

Sugiyamaella lignohabitans bifunctional glycerol-3-phosphate/glycerone-phosphate O-acyltransferase SCT1 (SCT1), partial mRNA. (2082 bp)

AA sequence:KEGG_Orthology:K13507" /note="Glycerol 3-phosphate/dihydroxyacetone phosphate sn-1 acyltransferase; dual substrate-specific acyltransferase of the glycerolipid biosynthesis pathway; prefers 16-carbon fatty acids; similar to Gpt2p; gene is constitutively transcribed; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 19525420]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018878300.1 - Sugiyamaella lignohabitans - NCBI

Saccharomyces cerevisiae S288C pheromone-regulated DUP240 family protein PRM9 (PRM9), partial mRNA. (897 bp)

Qualifiers source 1..897 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="I" gene 897 /gene="PRM9" /locus_tag="YAR031W" /db_xref="GeneID:851282" CDS 1..897 /gene="PRM9" /locus_tag="YAR031W" /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic reticulum [PMID:26928762]" /experiment="EXISTENCE:direct assay:GO:0005886 plasma membrane [PMID:12101299]" /experiment="EXISTENCE:physical interaction:GO:0005783 endoplasmic reticulum [PMID:12925749]" /note="Pheromone-regulated protein; contains 3 predicted transmembrane segments and an...

NM_001178224.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD

Sugiyamaella lignohabitans 3-dehydrosphinganine reductase (TSC10), partial mRNA. (963 bp)

in phytosphingosine synthesis; essential for growth in the absence of exogenous dihydrosphingosine or phytosphingosine; localized to lipid droplets; member of short chain dehydrogenase/reductase protein family; GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO...

XM_018879960.1 - Sugiyamaella lignohabitans - NCBI

Fulvia fulva uncharacterized protein (CLAFUR5_07983), partial mRNA. (924 bp)

taxon:5499" /chromosome="3" /geo_loc_name="France" /collection_date="1979" gene 924 /locus_tag="CLAFUR5_07983" /db_xref="GeneID:71987861" CDS 1..924 /locus_tag="CLAFUR5_07983" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_047759021.1" /db_xref="GeneID:71987861" /db_xref="GO:0005783|GO" /db_xref="GO:0006458" /db_xref="InterPro:IPR019623" /db_xref="PFAM:PF10681" /translation="...

XM_047907131.1 - Fulvia fulva - NCBI

Saccharomyces cerevisiae S288C DUP240 family protein MST28 (MST28), partial mRNA. (705 bp)

Qualifiers source 1..705 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="I" gene 705 /gene="MST28" /locus_tag="YAR033W" /db_xref="GeneID:851284" CDS 1..705 /gene="MST28" /locus_tag="YAR033W" /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic reticulum [PMID:26928762|PMID:12925749]" /experiment="EXISTENCE:direct assay:GO:0005794 Golgi apparatus [PMID:12925749]" /experiment="EXISTENCE:direct assay:GO:0016020 membrane [PMID:12925749]" /experiment="EXISTENCE:genetic interaction:GO:0016050 vesicle organization...

NM_001178225.1 - Saccharomyces cerevisiae S288C - NCBI - UCSC - SGD

Plasmodium chabaudi chabaudi protein transport protein USE1, putative (PCHAS_1222100), partial mRNA. (969 bp)

ucb@sanger.ac.uk; term=annotation;date=20181018;qualifier=removed_product=co nserved protein, unknown function;qualifier=added_product=protein transport protein use1, putative;qualifier=added_gene_name=use1;qualifier=added_li terature=pmid:12853481;qualifier=added_GO:0006890;qualifie r=added_GO:0005783;curatorName=ucb@sanger.ac.uk; ;query 322-322; ;query 299-321; ;query 1-298; tmhmm; query 1-323; pfam_scan;Pfam:PF09753.5; E()=2.8E-8;score=33.6;query 29-317;description=Use1; iprscan;InterPro:IPR019150 : Vesicle transport protein, Use1;Pfam:PF09753; score=2.9E-8;query 29-317;description=Vesicle...

XM_740208.1 - Plasmodium chabaudi chabaudi - NCBI

Sugiyamaella lignohabitans Nsg2p (NSG2), partial mRNA. (1206 bp)

involved in regulation of sterol biosynthesis; specifically stabilizes Hmg2p, one of two HMG-CoA isoenzymes that catalyze the rate-limiting step in sterol biosynthesis; homolog of mammalian INSIG proteins; NSG2 has a paralog, NSG1, that arose from the whole genome duplication; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 14562095]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016020 -...

XM_018880185.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans Sil1p (SIL1), partial mRNA. (1257 bp)

tag="AWJ20_3472" /inference="similar to AA sequence:KEGG_Orthology:K14001" /note="Nucleotide exchange factor for the ER lumenal Hsp70 chaperone Kar2p; required for protein translocation into the endoplasmic reticulum (ER); homolog of Yarrowia lipolytica SLS1; GrpE-like protein; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IPI] [PMID 10958688]; GO_component: GO:0005788 - endoplasmic reticulum lumen [Evidence IEA]; GO_function: GO:0000774 - adenyl-nucleotide exchange factor activity [Evidence IDA,IPI]...

XM_018880491.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans C-8 sterol isomerase ERG2 (ERG2), partial mRNA. (480 bp)

CDS 1..480 /gene="ERG2" /locus_tag="AWJ20_2679" /inference="similar to AA sequence:KEGG_Orthology:K09829" /note="C-8 sterol isomerase; catalyzes the isomerization of the delta-8 double bond to the delta-7 position at an intermediate step in ergosterol biosynthesis; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IC] [PMID 18459942]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO:0016020 - membrane...

XM_018879638.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans Pbn1p (PBN1), partial mRNA. (720 bp)

KEGG_Orthology:K07541" /note="Component of glycosylphosphatidylinositol-mannosyltransferase I; essential component; required for the autocatalytic post-translational processing of the protease B precursor Prb1p; localizes to ER in lumenal orientation; homolog of mammalian PIG-X; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 9649520]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA,IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA]; GO_component: GO...

XM_018881475.1 - Sugiyamaella lignohabitans - NCBI

Sugiyamaella lignohabitans Thi73p (THI73), partial mRNA. (807 bp)

GeneID:30036498" CDS 1..807 /gene="THI73" /locus_tag="AWJ20_4373" /note="Putative plasma membrane permease; proposed to be involved in carboxylic acid uptake and repressed by thiamine; substrate of Dbf2p/Mob1p kinase; transcription is altered if mitochondrial dysfunction occurs; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID 16850348]; GO_component: GO:0005789 - endoplasmic reticulum membrane [Evidence IEA]; GO_component: GO:0016021 - integral component of membrane [Evidence IEA,IEA]; GO_component: GO...

XM_018881437.1 - Sugiyamaella lignohabitans - NCBI

Data Export:

Tab-delimited text: Open in new window | Download
You can copy-paste the result into spreadsheet softwares (e.g. Excel) or text editors.
JSON format: Link | Download

Debug Info:

0.000 | 0.000 | search_start;
0.098 | 0.098 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:GO%5c%3a0005783)%7C(nt:GO%5c%3a0005783)%7C(aa:GO%5c%3a0005783))?to=0&format=json
0.294 | 0.196 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:GO%5c%3a0005783)%7C(nt:GO%5c%3a0005783)%7C(aa:GO%5c%3a0005783))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.299 | 0.005 | cgi_end;

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]

Summary:

Results:

Data Export:

Debug Info: