GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2021-10-17 14:38:46, GGRNA : RefSeq release 207 (Jul, 2021)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Rattus norvegicus homeobox B2 (Hoxb2), mRNA. (1657 bp)
LOCUS NM_001047091 1657 bp mRNA linear ROD 02-OCT-2017 DEFINITION Rattus norvegicus homeobox B2 (Hoxb2), mRNA. ACCESSION NM_001047091 XM_001081296 XM_220894 VERSION NM_001047091.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 608..766 /gene="Hoxb2" /gene_synonym="Hoxbes2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1657) AUTHORS Jolma A, Yan J, Whitington T, Toivonen J,...
Synonym: Hoxbes2
NM_001047091.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus paired related homeobox 2 (Prrx2), mRNA. (1230 bp)
gene="Prrx2" /gene_synonym="Prx2" /codon_start=1 /product="paired mesoderm homeobox protein 2" /protein_id="NP_001099209.1" /db_xref="GeneID:113931" /db_xref="RGD:1311471" /translation="MDSAAAAFALDPPAPGPGPPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVPGPEAREGAAREPSGGSSGSEAAPQDGECAAPGHGSATKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTLSPDYLSWPASSPYSSVPPYSPGGSSPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN" misc_feature 464..622 /gene="Prrx2" /gene_synonym="Prx2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature <482..796 /gene="...
Synonym: Prx2
NM_001105739.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 21-JUN-2021 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 20-JUN-2021 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. (794 bp)
feature 58..60 /gene="Rhox5" /gene_synonym="Pem" /note="upstream in-frame stop codon" exon 94..175 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" CDS 97..723 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.2" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="...
Synonym: Pem
NM_022175.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3), mRNA. (908 bp)
LOCUS NM_001135607 908 bp mRNA linear ROD 16-MAR-2021 DEFINITION Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3), mRNA. ACCESSION NM_001135607 VERSION NM_001135607.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...Rhox3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 685..843 /gene="Rhox3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 401..764 /gene="Rhox3" /inference="alignment:Splign:2.1.0" exon 765..810 /gene="...
NM_001135607.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 4G (Rhox4g), mRNA. (829 bp)
LOCUS NM_001024889 829 bp mRNA linear ROD 16-MAR-2021 DEFINITION Rattus norvegicus reproductive homeobox 4G (Rhox4g), mRNA. ACCESSION NM_001024889 XM_233314 VERSION NM_001024889.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ058652.1. On Jun 17, 2005 this sequence...
NM_001024889.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box B8 (Hoxb8), mRNA. (973 bp)
reference sequence was derived from JACYVU010000220.1. On Jul 17, 2010 this sequence version replaced XM_220888.4. Summary: mouse homolog is a homeobox transcription factor; involved in control of developmental pathways [RGD, Feb 2006]. Sequence Note: The RefSeq transcript and protein were derived...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 448..609 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 1..424 /gene="Hoxb8" /gene_synonym="Hox2r1a" /inference="alignment:Splign:2.1.0" STS...
Synonym: Hox2r1a
NM_001191649.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox C8 (Hoxc8), mRNA. (1228 bp)
FEATURES Location/Qualifiers source 1..1228 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..1228 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox C8" /db_xref="GeneID:24460" /db_xref="RGD:2821" CDS 1..729 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox protein R4; Homeobox gene C8; homeo box C8" /codon_start=1 /product="homeobox protein Hox-C8" /protein_id="NP_001170797.2" /db_xref="GeneID:24460" /db_xref="RGD:2821" /translation="...
Synonym: Hox3r4
NM_001177326.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus mesenchyme homeobox 2 (Meox2), mRNA. (2247 bp)
LOCUS NM_017149 2247 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus mesenchyme homeobox 2 (Meox2), mRNA. ACCESSION NM_017149 VERSION NM_017149.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...from UniProtKB/Swiss-Prot (P39020.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 760..921 /gene="Meox2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1027..1101 /gene="Meox2" /note="propagated from UniProtKB/Swiss-Prot...
NM_017149.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box A5 (Hoxa5), mRNA. (2938 bp)
review. The reference sequence was derived from JACYVU010000142.1. On Oct 25, 2019 this sequence version replaced XM_003752180.2. Summary: homeobox transcription factor; may be important for pattern specification [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the...Hoxa5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 2419..2580 /gene="Hoxa5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" exon 2387..2938 /gene="Hoxa5" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1...
NM_024389.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H2.0-like homeobox (Hlx), mRNA. (2141 bp)
LOCUS NM_001077674 2141 bp mRNA linear ROD 19-JUN-2021 DEFINITION Rattus norvegicus H2.0-like homeobox (Hlx), mRNA. ACCESSION NM_001077674 XM_001064868 XM_344184 VERSION NM_001077674.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1148..1309 /gene="Hlx" /gene_synonym="Hlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 1304..1525 /gene="Hlx" /gene_synonym="Hlx1" /note="propagated from UniProtKB/...
Synonym: Hlx1
NM_001077674.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox A7 (Hoxa7), mRNA. (910 bp)
mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="4" /map="4q24" gene 1..910 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /note="homeobox A7" /db_xref="GeneID:500126" /db_xref="RGD:1587253" exon 1..476 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /inference="alignment:Splign:2.1.0" misc_feature 65..67 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /note="upstream in-frame stop codon" CDS 101..790 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /note="Homeobox gene A7; hox-1.1; homeobox protein Hox-A7-like; homeobox protein R5; homeobox protein Hox-1.1; homeobox A9" /codon_start=1 /product="...
Synonym: Hox1r5; Hoxa9
NM_001109233.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box A2 (Hoxa2), mRNA. (1634 bp)
hox-1.11; Hoxa-2; Hoxa11; RATHOX111A" /db_xref="UniSTS:491328" misc_feature 53..55 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; RATHOX111A" /note="upstream in-frame stop codon" CDS 158..1276 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; RATHOX111A" /note="Homeobox gene A11; Homeobox gene A2; homeobox protein Hox-1.11" /codon_start=1 /product="homeobox protein Hox-A2" /protein_id="NP_036713.2" /db_xref="GeneID:103690123" /db_xref="RGD:2813" /translation="...
Synonym: hox-1.11; Hoxa-2; Hoxa11; RATHOX111A
NM_012581.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ventral anterior homeobox 2 (Vax2), mRNA. (879 bp)
misc_feature 220..303 /gene="Vax2" /note="Region: vax upstream domain" misc_feature 304..483 /gene="Vax2" /note="Region: homeobox" misc_feature order(307..321,325..327,376..378,394..396,433..435, 439..444,451..456,460..468,472..477) /gene="Vax2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 313..474 /gene="Vax2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(313..315,322..324,442..444,451..456,463..465) /gene="Vax2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_...
NM_022637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus NK2 homeobox 5 (Nkx2-5), mRNA. (1427 bp)
note="rNKx-2.5; homeobox protein NK-2 homolog E" /codon_start=1 /product="homeobox protein Nkx-2.5" /protein_id="NP_446103.2" /db_xref="GeneID:114109" /db_xref="RGD:620520" /translation="MFPSPALTHTPFSVKDILNLEQQQRSLAAGDLSARLEATLAPASCMLAAFKPEAYSGPEAAAPGLAELRAELGPAPSPPKCSPAFPTAPTFYPRAYGDPDPAKDPRADKKELCALQKAVELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELLGARRIAVPVLVRDGKPCLGDSAAYAPAYGVGLNAYGYNAYPYPGYGGAACSPAYSCAAAYPAAPPAAQPPAAAANSNFVNFGVGDLNTVQSPGMPQGNSGVSTLHGIRAW" misc_feature 536..688 /gene="Nkx2-5" /gene_synonym="Csx; Nkx2.5" /note="Homeobox domain; Region:...
Synonym: Csx; Nkx2.5
NM_053651.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 5 (Lhx5), mRNA. (1890 bp)
LOCUS NM_139036 1890 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus LIM homeobox 5 (Lhx5), mRNA. ACCESSION NM_139036 VERSION NM_139036.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="Lhx5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 884..1048 /gene="Lhx5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(884..886,893..895,1013..1015,1022..1027,1034..1036) /gene="Lhx5" /note="specific DNA base...
NM_139036.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box D3 (Hoxd3), mRNA. (2527 bp)
synonym="Hox4r6" /inference="alignment:Splign:2.1.0" STS 349..1945 /gene="Hoxd3" /gene_synonym="Hox4r6" /db_xref="UniSTS:491330" misc_feature 376..378 /gene="Hoxd3" /gene_synonym="Hox4r6" /note="upstream in-frame stop codon" CDS 382..1680 /gene="Hoxd3" /gene_synonym="Hox4r6" /note="homeobox protein R6; Homeobox gene D3" /codon_start=1 /product="homeobox protein Hox-D3" /protein_id="NP_001257967.1" /db_xref="GeneID:288152" /db_xref="RGD:1588601" /translation="...
Synonym: Hox4r6
NM_001271038.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box C4 (Hoxc4), mRNA. (2068 bp)
synonym="Hox3r3" /inference="alignment:Splign:2.1.0" STS 151..1416 /gene="Hoxc4" /gene_synonym="Hox3r3" /db_xref="UniSTS:491379" misc_feature 356..358 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="upstream in-frame stop codon" CDS 428..1222 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="homeobox protein R3; Homeobox gene C4" /codon_start=1 /product="homeobox protein Hox-C4" /protein_id="NP_001103354.1" /db_xref="GeneID:24459" /db_xref="RGD:1586210" /translation="...
Synonym: Hox3r3
NM_001109884.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ventral anterior homeobox 1 (Vax1), mRNA. (1011 bp)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 214..297 /gene="Vax1" /note="Region: vax upstream domain" misc_feature 298..477 /gene="Vax1" /note="Region: homeobox" misc_feature order(301..315,319..321,370..372,388..390,427..429, 433..438,445..450,454..462,466..471) /gene="Vax1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 307..468 /gene="Vax1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(307..309,316..318,436..438,445..450,457..459) /gene="Vax1" /note="specific DNA base contacts...
NM_022636.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box B7 (Hoxb7), mRNA. (1235 bp)
sequence was derived from BC079340.1. On Apr 29, 2005 this sequence version replaced XM_573181.1. Summary: mouse homolog is a DNA-binding homeobox transcription factor; may play a role in development of the haemopoietic system [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 440..598 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 596..676 /gene="Hoxb7" /gene_synonym="Hox2r1b; R1b" /note="propagated from...
Synonym: Hox2r1b; R1b
NM_001017480.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus UNC homeobox (Uncx), mRNA. (2388 bp)
LOCUS NM_017179 2388 bp mRNA linear ROD 03-JUL-2021 DEFINITION Rattus norvegicus UNC homeobox (Uncx), mRNA. ACCESSION NM_017179 XM_001065224 VERSION NM_017179.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 833..997 /gene="Uncx" /gene_synonym="Chx4; PHD1; Uncx4.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 992..1585 /gene="Uncx" /gene_synonym="Chx4; PHD1; Uncx4.1" /note="propagated from...
Synonym: Chx4; PHD1; Uncx4.1
NM_017179.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus developing brain homeobox 1 (Dbx1), mRNA. (1008 bp)
LOCUS NM_001009644 1008 bp mRNA linear ROD 19-JUN-2021 DEFINITION Rattus norvegicus developing brain homeobox 1 (Dbx1), mRNA. ACCESSION NM_001009644 XM_218605 VERSION NM_001009644.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...gene="Dbx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 550..711 /gene="Dbx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(550..552,559..561,679..681,688..693,700..702) /gene="Dbx1" /note="specific DNA base...
NM_001009644.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox A6 (Hoxa6), mRNA. (876 bp)
note="upstream in-frame stop codon" CDS 99..800 /gene="Hoxa6" /note="homeobox protein Hox-A6-like" /codon_start=1 /product="homeobox protein Hox-A6" /protein_id="NP_001178016.1" /db_xref="GeneID:685732" /db_xref="RGD:1590236" /translation="MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGNSKQRGPGDYLHFSPEQQYKPDSSSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQASGEDSEAKAGE" misc_feature 573..734 /gene="Hoxa6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" STS 106..173 /...
NM_001191087.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 4 (Lhx4), mRNA. (1908 bp)
LOCUS NM_001108348 1908 bp mRNA linear ROD 12-MAR-2021 DEFINITION Rattus norvegicus LIM homeobox 4 (Lhx4), mRNA. ACCESSION NM_001108348 XM_001072440 XM_039090907 XM_341135 VERSION NM_001108348.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa;...gene="Lhx4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 720..884 /gene="Lhx4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(720..722,729..731,849..851,858..863,870..872) /gene="Lhx4" /note="specific DNA base...
NM_001108348.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H6 family homeobox 1 (Hmx1), mRNA. (1522 bp)
LOCUS NM_001108363 1522 bp mRNA linear ROD 18-MAR-2021 DEFINITION Rattus norvegicus H6 family homeobox 1 (Hmx1), mRNA. ACCESSION NM_001108363 XM_001064149 XM_341238 VERSION NM_001108363.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000254.1. On Mar...
NM_001108363.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 9 (Lhx9), mRNA. (1298 bp)
LOCUS NM_181367 1298 bp mRNA linear ROD 19-JUN-2021 DEFINITION Rattus norvegicus LIM homeobox 9 (Lhx9), mRNA. ACCESSION NM_181367 XM_001066548 VERSION NM_181367.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...from UniProtKB/Swiss-Prot (Q80W90.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 910..1071 /gene="Lhx9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1087..1194 /gene="Lhx9" /note="propagated from UniProtKB/Swiss-Prot...
NM_181367.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox and leucine zipper encoding (Homez), mRNA. (1785 bp)
LOCUS NM_152849 1785 bp mRNA linear ROD 13-APR-2021 DEFINITION Rattus norvegicus homeobox and leucine zipper encoding (Homez), mRNA. ACCESSION NM_152849 VERSION NM_152849.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC084701.1. On Oct 28, 2005 this...
NM_152849.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus paired related homeobox 1 (Prrx1), mRNA. (1377 bp)
LOCUS NM_153821 1377 bp mRNA linear ROD 03-JUL-2021 DEFINITION Rattus norvegicus paired related homeobox 1 (Prrx1), mRNA. ACCESSION NM_153821 VERSION NM_153821.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...; Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 624..782 /gene="Prrx1" /gene_synonym="Pmx1; Prx-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(627..629,747..749,756..761,768..770) /gene="Prrx1" /gene_synonym="Pmx1;...
Synonym: Pmx1; Prx-1
NM_153821.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus BarH-like homeobox 1 (Barhl1), mRNA. (2392 bp)
LOCUS NM_057109 2392 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus BarH-like homeobox 1 (Barhl1), mRNA. ACCESSION NM_057109 VERSION NM_057109.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...; Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 1304..1465 /gene="Barhl1" /gene_synonym="Barhl2; Mbh2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1667..1741 /gene="Barhl1" /gene_synonym="Barhl2; Mbh2" /note="propagated...
Synonym: Barhl2; Mbh2
NM_057109.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus dorsal root ganglia homeobox (Drgx), mRNA. (2403 bp)
related homeobox protein-like 1; paired-like homeodomain trancription factor Drg11" /codon_start=1 /product="dorsal root ganglia homeobox protein" /protein_id="NP_665710.2" /db_xref="GeneID:252880" /db_xref="RGD:628616" /translation="MFYFHCPPQLEGTAPFGNHSTGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFFPSCLPGTLLNTATYAQALSHVASLKGGPLCSCCVPDPMGLSFLPTYGCQSNRTASVAALRMKAREHSEAVLQSANLLPSTSSSPGPASKQVPPEGSQDKPSPTKEQSEGEKSV" misc_feature 387..548 /gene="Drgx" /gene_synonym="Drg11; Prrxl1" /note="Homeobox domain; Region:...
Synonym: Drg11; Prrxl1
NM_145767.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ladybird homeobox 1 (Lbx1), mRNA. (1164 bp)
LOCUS NM_001047108 1164 bp mRNA linear ROD 20-JUN-2021 DEFINITION Rattus norvegicus ladybird homeobox 1 (Lbx1), mRNA. ACCESSION NM_001047108 XM_001058110 XM_574675 VERSION NM_001047108.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 385..546 /gene="Lbx1" /gene_synonym="RGD1564197" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(385..387,394..396,514..516,523..528,535..537) /gene="Lbx1" /gene_synonym="...
Synonym: RGD1564197
NM_001047108.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box C12 (Hoxc12), mRNA. (843 bp)
FEATURES Location/Qualifiers source 1..843 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..843 /gene="Hoxc12" /note="homeo box C12" /db_xref="GeneID:300262" /db_xref="RGD:1310539" CDS 1..843 /gene="Hoxc12" /codon_start=1 /product="homeobox protein Hox-C12" /protein_id="NP_001100266.1" /db_xref="GeneID:300262" /db_xref="RGD:1310539" /translation="...
NM_001106796.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus paired-like homeobox 2a (Phox2a), mRNA. (1608 bp)
ARIX1 homeodomain protein; aristaless homeobox protein homolog" /codon_start=1 /product="paired mesoderm homeobox protein 2A" /protein_id="NP_446321.2" /db_xref="GeneID:116648" /db_xref="RGD:621323" /translation="MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAASAKGAAGATGAKKGEARCSSEDDDSKESTCSPTPDSTASLAPSLASPRLSPSPLPAALGSGPGPQPLKGALWAGVAPGAGAAELLKAWQPAEPGPGPFSGVLSSFHRKPGPALKTNLF" misc_feature 476..637 /gene="Phox2a" /gene_synonym="Arix" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Arix
NM_053869.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Rhox homeobox family member 7 (Rhox7), mRNA. (2802 bp)
LOCUS NM_001393802 2802 bp mRNA linear ROD 12-MAR-2021 DEFINITION Rattus norvegicus Rhox homeobox family member 7 (Rhox7), mRNA. ACCESSION NM_001393802 XM_039099574 VERSION NM_001393802.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000455.1. On Mar 12, 2021...
NM_001393802.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus goosecoid homeobox (Gsc), mRNA. (1158 bp)
alignment:Splign:2.1.0" CDS 113..883 /gene="Gsc" /note="homeobox protein goosecoid-like" /codon_start=1 /product="homeobox protein goosecoid" /protein_id="NP_001178802.1" /db_xref="GeneID:317715" /db_xref="RGD:631425" /translation="MPASMFSIDNILAARPRCKDAVLPVAPSAAAPVVFPALHGDSLYGAGGGTSSDYGAFYPRPVAPGGAGLPAAVGGSRLGYNSYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSKASPEKREEEGKSDLDSDS" misc_feature 599..763 /gene="Gsc" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001"...
NM_001191873.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus one cut homeobox 3 (Onecut3), mRNA. (1659 bp)
LOCUS NM_001394957 1659 bp mRNA linear ROD 12-MAY-2021 DEFINITION Rattus norvegicus one cut homeobox 3 (Onecut3), mRNA. ACCESSION NM_001394957 VERSION NM_001394957.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000177.1. ##Evidence-Data-START##...
NM_001394957.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus NK3 homeobox 1 (Nkx3-1), mRNA. (1800 bp)
t="homeobox protein Nkx-3.1" /protein_id="NP_001029316.1" /db_xref="GeneID:305999" /db_xref="RGD:1305369" /translation="MLRVAEPQEARLEAGGRSPWAAPPTQSKRLTSFLIQDILRDHAERRGGQPSTPQHQCQPDPKRDSASELDEAEGSSVTLEDPPGIRSSPTETRAETESDAHFETYLLDCEHTPVLSSAPQVTKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRRQLSEDLGVLEKNSTLSLPTLKDDSLSRASLVSVYASYPYYPYLYCLGSWHPTFW" misc_feature order(383..397,401..403,452..454,470..472,509..511, 515..520,527..532,536..544,548..553) /gene="Nkx3-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 389..550 /gene="Nkx3-1" /note="Homeobox...
NM_001034144.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus SIX homeobox 3 (Six3), mRNA. (2677 bp)
LOCUS NM_023990 2677 bp mRNA linear ROD 26-FEB-2021 DEFINITION Rattus norvegicus SIX homeobox 3 (Six3), mRNA. ACCESSION NM_023990 XM_001059990 VERSION NM_023990.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000163.1. On Feb 26, 2021 this sequence...
NM_023990.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus POU class 6 homeobox 2 (Pou6f2), mRNA. (6320 bp)
misc_feature 1677..2006 /gene="Pou6f2" /note="Pou domain - N-terminal to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:419906" misc_feature 2076..2240 /gene="Pou6f2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 436..527 /gene="Pou6f2" /inference="alignment:Splign:2.1.0" exon 528..756 /gene="Pou6f2" /inference="alignment:Splign:2.1.0" exon 757..1133 /gene="Pou6f2" /inference="alignment:Splign:2.1.0" exon 1134..1274 /gene="Pou6f2" /inference="alignment:Splign:2.1.0" exon 1275..1481 /gene="Pou6f2" /inference="alignment:Splign:2.1.0" exon 1482..1650 /gene...
NM_001101002.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus BarH-like homeobox 2 (Barhl2), mRNA. (1577 bp)
LOCUS NM_022956 1577 bp mRNA linear ROD 20-JUN-2021 DEFINITION Rattus norvegicus BarH-like homeobox 2 (Barhl2), mRNA. ACCESSION NM_022956 VERSION NM_022956.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 766..924 /gene="Barhl2" /gene_synonym="Barh; MBH1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 1159..1221 /gene="Barhl2" /gene_synonym="Barh; MBH1" /note="propagated...
Synonym: Barh; MBH1
NM_022956.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus msh homeobox 2 (Msx2), mRNA. (1976 bp)
homeobox 2" /db_xref="GeneID:25483" /db_xref="RGD:3116" CDS 1..804 /gene="Msx2" /note="hox-8.1; homeobox protein Hox-8-1; msh homeo box homolog 2" /codon_start=1 /product="homeobox protein MSX-2" /protein_id="NP_037114.2" /db_xref="GeneID:25483" /db_xref="RGD:3116" /translation="MASPSKGGDLFSSDEEGPAVLAGPGPGPGGAEGGAEERRVKVSSLPFSVEALMSDKKPPKESPAVPPDCASAGAVLRPLLLPGHGVRDAHSPGPLVKPFETASVKSENSEDGAPWIQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYSASYPFHRPVLPIPPVGLYATPVGYGMYHLS" misc_feature 433..597 /gene="Msx2" /note="Homeobox...
NM_012982.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 2 (Lhx2), mRNA. (1903 bp)
LOCUS NM_001106571 1903 bp mRNA linear ROD 18-JUN-2021 DEFINITION Rattus norvegicus LIM homeobox 2 (Lhx2), mRNA. ACCESSION NM_001106571 XM_001054855 XM_216050 VERSION NM_001106571.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature 867..1028 /gene="Lhx2" /gene_synonym="Lh-2; LH2A" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 180..382 /gene="Lhx2" /gene_synonym="Lh-2; LH2A" /inference="alignment:Splign:2.1.0" exon...
Synonym: Lh-2; LH2A
NM_001106571.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus retina and anterior neural fold homeobox (Rax), mRNA. (1029 bp)
LOCUS NM_053678 1029 bp mRNA linear ROD 21-JUN-2021 DEFINITION Rattus norvegicus retina and anterior neural fold homeobox (Rax), mRNA. ACCESSION NM_053678 VERSION NM_053678.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 421..579 /gene="Rax" /gene_synonym="Rx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 625..885 /gene="Rax" /gene_synonym="Rx" /note="propagated from UniProtKB/...
Synonym: Rx
NM_053678.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus distal-less homeobox 1 (Dlx1), mRNA. (2757 bp)
LOCUS NM_001100531 2757 bp mRNA linear ROD 10-APR-2021 DEFINITION Rattus norvegicus distal-less homeobox 1 (Dlx1), mRNA. ACCESSION NM_001100531 XM_001059233 XM_230987 VERSION NM_001100531.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata...gene="Dlx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 940..1104 /gene="Dlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(940..942,949..951,1069..1071,1078..1083,1090..1092) /gene="Dlx1" /note="specific DNA base...
NM_001100531.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus pancreatic and duodenal homeobox 1 (Pdx1), mRNA. (1406 bp)
LOCUS NM_022852 1406 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus pancreatic and duodenal homeobox 1 (Pdx1), mRNA. ACCESSION NM_022852 VERSION NM_022852.4 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 570..734 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(570..572,579..581,699..701,708..713,720..722) /gene="Pdx1" /gene_...
Synonym: Idx1; Ipf1; Stf1
NM_022852.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 1 (Lhx1), mRNA. (3390 bp)
LOCUS NM_145880 3390 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus LIM homeobox 1 (Lhx1), mRNA. ACCESSION NM_145880 VERSION NM_145880.4 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="Lhx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1147..1311 /gene="Lhx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(1147..1149,1156..1158,1276..1278,1285..1290, 1297..1299) /gene="Lhx1" /note="specific DNA...
NM_145880.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus NK6 homeobox 1 (Nkx6-1), mRNA. (3221 bp)
LOCUS NM_031737 3221 bp mRNA linear ROD 03-JUL-2021 DEFINITION Rattus norvegicus NK6 homeobox 1 (Nkx6-1), mRNA. ACCESSION NM_031737 XM_346455 VERSION NM_031737.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...from UniProtKB/Swiss-Prot (O35762.1); methylation site" misc_feature 1515..1679 /gene="Nkx6-1" /gene_synonym="Nkx6.1; Nkx61; Nkx6a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1680..1892 /gene="Nkx6-1" /gene_synonym="Nkx6.1; Nkx61; Nkx6a" /note="propagated...
Synonym: Nkx6.1; Nkx61; Nkx6a
NM_031737.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus POU class 6 homeobox 1 (Pou6f1), mRNA. (2231 bp)
SAM:MobiDB-lite" misc_feature 1215..1439 /gene="Pou6f1" /gene_synonym="Brn5" /note="Pou domain - N-terminal to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:304656" misc_feature order(1503..1517,1521..1523,1572..1574,1590..1592, 1629..1631,1635..1640,1647..1652,1656..1664,1668..1673) /gene="Pou6f1" /gene_synonym="Brn5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1509..1670 /gene="Pou6f1" /gene_synonym="Brn5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order...
Synonym: Brn5
NM_001105746.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus distal-less homeobox 5 (Dlx5), mRNA. (1390 bp)
LOCUS NM_012943 1390 bp mRNA linear ROD 21-JUN-2021 DEFINITION Rattus norvegicus distal-less homeobox 5 (Dlx5), mRNA. ACCESSION NM_012943 VERSION NM_012943.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...Swiss-Prot (P50575.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 272..532 /gene="Dlx5" /gene_synonym="RDLX" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="CDD:289198" misc_feature 278..280 /gene="Dlx5" /gene_synonym="RDLX" /note...
Synonym: RDLX
NM_012943.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/en/rn/homeobox
lang : en | div : | spe : rn | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.133 | 0.133 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Rattus norvegicus (Norway rat)?to=0&format=json
0.276 | 0.143 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Rattus norvegicus (Norway rat)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.282 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]