LOCUS       NM_053651               1427 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus NK2 homeobox 5 (Nkx2-5), mRNA.
ACCESSION   NM_053651
VERSION     NM_053651.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1427)
  AUTHORS   Lai G, Wang L, Li Z and Zhao Y.
  TITLE     Homocysteine downregulates cardiac homeobox transcription factor
            NKX2.5 via IGFBP5
  JOURNAL   Am J Physiol Heart Circ Physiol 319 (6), H1380-H1386 (2020)
   PUBMED   33035436
  REMARK    GeneRIF: Homocysteine downregulates cardiac homeobox transcription
            factor NKX2.5 via IGFBP5.
REFERENCE   2  (bases 1 to 1427)
  AUTHORS   Wang H, Liu Y, Han S, Zi Y, Zhang Y, Kong R, Liu Z, Cai Z, Zhong C,
            Liu W, Li L and Jiang L.
  TITLE     Nkx2-5 Regulates the Proliferation and Migration of H9c2 Cells
  JOURNAL   Med Sci Monit 26, e925388 (2020)
   PUBMED   32780729
  REMARK    GeneRIF: Nkx2-5 Regulates the Proliferation and Migration of H9c2
            Cells.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1427)
  AUTHORS   Liang X, Chu G, Wang L, Lai G and Zhao Y.
  TITLE     Role of Nkx2.5 in H2O2-induced Nsd1 suppression
  JOURNAL   Cell Stress Chaperones 24 (4), 697-707 (2019)
   PUBMED   31104268
  REMARK    GeneRIF: The authors findings suggest that Nkx2.5, as a
            transcription factor, may be a regulatory element connecting
            different signaling pathways in response to oxidative stress and
            that reduced Nsd1 (Nuclear receptor-binding SET domain-containing
            protein 1) expression could lead to the alteration of global H3K36
            and H4K20 methylation, influencing cardiac development.
REFERENCE   4  (bases 1 to 1427)
  AUTHORS   Syam N, Chatel S, Ozhathil LC, Sottas V, Rougier JS, Baruteau A,
            Baron E, Amarouch MY, Daumy X, Probst V, Schott JJ and Abriel H.
  TITLE     Variants of Transient Receptor Potential Melastatin Member 4 in
            Childhood Atrioventricular Block
  JOURNAL   J Am Heart Assoc 5 (5), e001625 (2016)
   PUBMED   27207958
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1427)
  AUTHORS   Fu Y, Ruiz-Lozano P and Evans SM.
  TITLE     A rat homeobox gene, rNKx-2.5, is a homologue of the tinman gene in
            Drosophila and is mainly expressed during heart development
  JOURNAL   Dev Genes Evol 207 (5), 352-358 (1997)
   PUBMED   27747432
REFERENCE   6  (bases 1 to 1427)
  AUTHORS   Durocher D, Charron F, Warren R, Schwartz RJ and Nemer M.
  TITLE     The cardiac transcription factors Nkx2-5 and GATA-4 are mutual
            cofactors
  JOURNAL   EMBO J 16 (18), 5687-5696 (1997)
   PUBMED   9312027
REFERENCE   7  (bases 1 to 1427)
  AUTHORS   Biben C and Harvey RP.
  TITLE     Homeodomain factor Nkx2-5 controls left/right asymmetric expression
            of bHLH gene eHand during murine heart development
  JOURNAL   Genes Dev 11 (11), 1357-1369 (1997)
   PUBMED   9192865
REFERENCE   8  (bases 1 to 1427)
  AUTHORS   Chen CY and Schwartz RJ.
  TITLE     Recruitment of the tinman homolog Nkx-2.5 by serum response factor
            activates cardiac alpha-actin gene transcription
  JOURNAL   Mol Cell Biol 16 (11), 6372-6384 (1996)
   PUBMED   8887666
REFERENCE   9  (bases 1 to 1427)
  AUTHORS   Chen CY, Croissant J, Majesky M, Topouzis S, McQuinn T, Frankovsky
            MJ and Schwartz RJ.
  TITLE     Activation of the cardiac alpha-actin promoter depends upon serum
            response factor, Tinman homologue, Nkx-2.5, and intact serum
            response elements
  JOURNAL   Dev Genet 19 (2), 119-130 (1996)
   PUBMED   8900044
REFERENCE   10 (bases 1 to 1427)
  AUTHORS   Lyons I, Parsons LM, Hartley L, Li R, Andrews JE, Robb L and Harvey
            RP.
  TITLE     Myogenic and morphogenetic defects in the heart tubes of murine
            embryos lacking the homeo box gene Nkx2-5
  JOURNAL   Genes Dev 9 (13), 1654-1666 (1995)
   PUBMED   7628699
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000219.1.
            
            On Nov 26, 2020 this sequence version replaced NM_053651.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF006664.1, CK359509.1 [ECO:0000332]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-437               JACYVU010000219.1  4377460-4377896
            438-1427            JACYVU010000219.1  4379329-4380318
FEATURES             Location/Qualifiers
     source          1..1427
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q12"
     gene            1..1427
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx2.5"
                     /note="NK2 homeobox 5"
                     /db_xref="GeneID:114109"
                     /db_xref="RGD:620520"
     exon            1..437
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx2.5"
                     /inference="alignment:Splign:2.1.0"
     CDS             107..1066
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx2.5"
                     /note="rNKx-2.5; homeobox protein NK-2 homolog E"
                     /codon_start=1
                     /product="homeobox protein Nkx-2.5"
                     /protein_id="NP_446103.2"
                     /db_xref="GeneID:114109"
                     /db_xref="RGD:620520"
                     /translation="

MFPSPALTHTPFSVKDILNLEQQQRSLAAGDLSARLEATLAPASCMLAAFKPEAYSGPEAAAPGLAELRAELGPAPSPPKCSPAFPTAPTFYPRAYGDPDPAKDPRADKKELCALQKAVELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELLGPPPPPARRIAVPVLVRDGKPCLGDSAAYAPAYGVGLNAYGYNAYPYPGYGGAACSPAYSCAAAYPAAPPAAQPPAAAANSNFVNFGVGDLNTVQSPGMPQGNSGVSTLHGIRAW"

     misc_feature    536..685
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx2.5"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            438..1427
                     /gene="Nkx2-5"
                     /gene_synonym="Csx; Nkx2.5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cgggtgcgcgggcggacagcgggcaccatgcgggaaggctatccccgggggtgggcagtgccactctctgccacccacctggcgctgtgagaccggcgtcgccaccatgttccccagccctgcgctcacacacacgcccttctcagtcaaagacatcctgaacctggagcagcagcagcgcagcctggcggctggggacctgtctgcgcgcctcgaggccaccctggcgcccgcctcctgcatgctggccgccttcaagccggaggcctactcaggccccgaggcggcagcgcccggcctggcagagctgcgcgcggagctgggccccgcgccttcgccccccaagtgctctcctgctttcccaaccgcccctacattttatccgcgagcctacggtgaccctgaccccgccaaggaccctcgggcggataagaaagagctgtgcgcgctgcagaaggcggtggagctggacaaagccgagacagacggcgccgagcgaccacgcgcgcggcggcgacggaagccacgcgtgctcttctcgcaggcgcaggtctatgagctggagcggcgcttcaagcaacagcggtacctgtcggcgcctgagcgcgaccaactggccagcgtgctgaagctcacgtccacgcaggtcaagatctggttccagaaccgccgctacaagtgtaagcgacagcggcaggaccagactctggagctgctggggccgccgccgccgcccgcgcgcaggatcgcggtgccggtgttggtgcgcgacgggaagccctgcctgggggactcggcggcctacgctcccgcctacggcgtgggtctcaacgcctacggctacaacgcctacccctatcccggctacggtggcgcggcctgcagtcccgcctacagctgcgcagccgcgtaccccgccgcgccccccgccgcgcagcccccagccgcagcggccaacagcaacttcgtgaacttcggcgtcggggacttgaacacggtgcagagtcccgggatgccacagggcaattcgggcgtctccacgctgcacggcatccgagcctggtagggaaagggcccgtctggggcaccccggaccgactcccacctttaggagaagggcgatgactccggggatggaaaggctcccactgtgtcctgtccctcggatttcacacccacacttgcgcaggcctgggacctttctccgatccatccccttttgttgacctaacctgatgcctcggtcctgggaaagcccttccagggccaaggcaccctccacggattcccatactaggacccggagcctgggccgggcgcccgggccctgggtgccttgccgccacccacccacccgtatttatgtttttacctgttgctgtaagaaatgagaaccctcttcccattaaagtgagtgcgctaacgca

//