GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-04 21:51:07, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001037581             714 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus reproductive homeobox 10 (Rhox10), mRNA.
ACCESSION   NM_001037581
VERSION     NM_001037581.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 714)
  AUTHORS   Borgmann J, Tuttelmann F, Dworniczak B, Ropke A, Song HW, Kliesch
            S, Wilkinson MF, Laurentino S and Gromoll J.
  TITLE     The human RHOX gene cluster: target genes and functional analysis
            of gene variants in infertile men
  JOURNAL   Hum Mol Genet 25 (22), 4898-4910 (2016)
   PUBMED   28171660
REFERENCE   2  (bases 1 to 714)
  AUTHORS   Geserick C, Weiss B, Schleuning WD and Haendler B.
  TITLE     OTEX, an androgen-regulated human member of the paired-like class
            of homeobox genes
  JOURNAL   Biochem J 366 (Pt 1), 367-375 (2002)
   PUBMED   11980563
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000455.1.
            
            On Aug 30, 2022 this sequence version replaced NM_001037581.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058657.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN13663609 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-418               JACYVU010000455.1  1807381-1807798
            419-464             JACYVU010000455.1  1809799-1809844
            465-714             JACYVU010000455.1  1811678-1811927
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq35"
     gene            1..714
                     /gene="Rhox10"
                     /gene_synonym="Rhoxf10"
                     /note="reproductive homeobox 10"
                     /db_xref="GeneID:652926"
                     /db_xref="RGD:1563291"
     exon            1..418
                     /gene="Rhox10"
                     /gene_synonym="Rhoxf10"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    6..8
                     /gene="Rhox10"
                     /gene_synonym="Rhoxf10"
                     /note="upstream in-frame stop codon"
     CDS             54..659
                     /gene="Rhox10"
                     /gene_synonym="Rhoxf10"
                     /note="reproductive homeobox on X chromosome 10; Rhox
                     homeobox family member 10"
                     /codon_start=1
                     /product="reproductive homeobox 10"
                     /protein_id="NP_001032670.1"
                     /db_xref="GeneID:652926"
                     /db_xref="RGD:1563291"
                     /translation="
MESKYFYFDLDYYGVSFYEEEIMTDSQQRVAAAAVRCRFGRGVRVLHELGQDEHLSFKYKQNYSYETRKETQARPSEPEKAAGTAACRSNNRQIKHHKFTYAQLCELEKAFQETQYPDAHRRKALAALIHVDECKVKAWFKNKRAKYRKKHKELLLSSATSGTLNNFSAQMNEDPKSSTSVPEEPIGFIVCQQHLGKSCWS"
     misc_feature    order(336..344,348..350,399..401,417..419,456..458,
                     462..467,474..479,483..491,495..500)
                     /gene="Rhox10"
                     /gene_synonym="Rhoxf10"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(336..338,345..347,465..467,474..479,486..488)
                     /gene="Rhox10"
                     /gene_synonym="Rhoxf10"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    348..497
                     /gene="Rhox10"
                     /gene_synonym="Rhoxf10"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            419..464
                     /gene="Rhox10"
                     /gene_synonym="Rhoxf10"
                     /inference="alignment:Splign:2.1.0"
     exon            465..714
                     /gene="Rhox10"
                     /gene_synonym="Rhoxf10"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcccgtgaactgggaggtgctccagagtaggctccatctgcaaagctctagcaatggaaagcaagtacttctacttcgacctcgactattatggggtgagcttctatgaggaagaaataatgactgactctcagcagagggttgccgcggcagcagtccgttgtcgctttggaagaggtgtaagagtcctgcatgagctaggccaggacgagcacctgagctttaaatacaagcaaaactacagctatgaaacaaggaaggaaacgcaagcccgtcccagtgagcctgagaaagcagctggaacagctgcttgtcgctccaacaacaggcaaataaaacaccacaagttcacctatgcccaactgtgtgaactggagaaggctttccaagagacccagtatcctgatgcacaccgaagaaaagcacttgcagccctcattcatgtggacgaatgcaaggtgaaggcttggtttaaaaataagagagctaaatacaggaaaaaacataaggaattactactcagcagtgctacatctggtaccttgaacaacttttctgctcagatgaatgaagaccccaagagtagtacctctgttccggaggagccaatagggttcatcgtgtgccagcaacatcttggcaaatcctgctggtcataaaaatattgttttgtcacatataatagcaataaagaaaggaagatgtttctcaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]