2024-05-04 18:22:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001108880 1372 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus BARX homeobox 1 (Barx1), mRNA. ACCESSION NM_001108880 XM_001056986 XM_344575 VERSION NM_001108880.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1372) AUTHORS Verzi MP, Stanfel MN, Moses KA, Kim BM, Zhang Y, Schwartz RJ, Shivdasani RA and Zimmer WE. TITLE Role of the homeodomain transcription factor Bapx1 in mouse distal stomach development JOURNAL Gastroenterology 136 (5), 1701-1710 (2009) PUBMED 19208343 REFERENCE 2 (bases 1 to 1372) AUTHORS Kim BM, Miletich I, Mao J, McMahon AP, Sharpe PA and Shivdasani RA. TITLE Independent functions and mechanisms for homeobox gene Barx1 in patterning mouse stomach and spleen JOURNAL Development 134 (20), 3603-3613 (2007) PUBMED 17855428 REFERENCE 3 (bases 1 to 1372) AUTHORS Kim BM, Buchner G, Miletich I, Sharpe PT and Shivdasani RA. TITLE The stomach mesenchymal transcription factor Barx1 specifies gastric epithelial identity through inhibition of transient Wnt signaling JOURNAL Dev Cell 8 (4), 611-622 (2005) PUBMED 15809042 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473977.1. On or before Oct 4, 2007 this sequence version replaced XM_344575.3, XM_001056986.1. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMEA5756307, SAMN12840105 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1372 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="17" /map="17p14" gene 1..1372 /gene="Barx1" /note="BARX homeobox 1" /db_xref="GeneID:364680" /db_xref="RGD:1310884" exon 1..306 /gene="Barx1" /inference="alignment:Splign:2.1.0" CDS 84..848 /gene="Barx1" /note="BarH-like homeobox 1" /codon_start=1 /product="homeobox protein BarH-like 1" /protein_id="NP_001102350.1" /db_xref="GeneID:364680" /db_xref="RGD:1310884" /translation="
MQRPGEPGSARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLGSALLAAGPGMPGTAGTSHLPLELQLRGKLEAAGSGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKEAEKPAETPGEPSDRSCED"
misc_feature order(510..524,528..530,579..581,597..599,636..638, 642..647,654..659,663..671,675..680) /gene="Barx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 516..677 /gene="Barx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(516..518,525..527,645..647,654..659,666..668) /gene="Barx1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 307..598 /gene="Barx1" /inference="alignment:Splign:2.1.0" exon 599..683 /gene="Barx1" /inference="alignment:Splign:2.1.0" exon 684..1372 /gene="Barx1" /inference="alignment:Splign:2.1.0" ORIGIN
ccggcctagagccccgcgcgggccccgcgccaaagcttagccgccgtcgctgcctagccgtggtcgcatccccgggagccgcgatgcagcggccgggggagccgggctccgcgcgcttcggtccgcccgagggctgtgcggatcatcgaccgcatcgctaccgcagcttcatgatcgaagagatcctcaccgagcctcccgggcccaagggcgcagcgcccgcggccgccgctgctgccgcgggcgagctgctcaagttcggcgtgcaggcgctgctggccgcccggcccttccacagccacctggcggtgctgaaggctgagcaggccgcagtgttcaagttcccactggcgccgctcggctgctctgggctgggctccgccttgttggccgcggggcctgggatgcccggcaccgcaggcacgtcgcacctgccactggagctgcaactccgcgggaagctggaagccgctggctcgggggaacctggcacgaaagccaagaaaggacgccggagccgcactgtattcactgagctgcagctgatgggtctggagaaacgcttcgagaagcagaagtacctctctaccccagacagaatagatctagctgaatccctgggcctgagccagttacaggtgaagacgtggtatcaaaatcggaggatgaaatggaagaaaatagtgctgcagggtggaggcctggagtcccccaccaagcccaagggacggcccaagaagaactccatccccacgagcgagcagctcacggagcaggagcgcgccaaggaggcagagaagccagcggagacaccgggcgagcccagcgatcgaagctgcgaggactgagcgtcgcggagggtgcggcgccttcagcggcgaccccaggagctggccctttcgtgctcaagccgtttgctttctaaacgtttcattactactttgaatgcggacagttacgggccagacaaggaaggacacaggcccggaagccaatcccaggtctcagcgagctcctgcccccagtctgggagagttgtgttcagcgtggccgaagcttctggtctttctcggacctccgcagtgccccggcgctccacgcgcattcacgtcccgctccttgcccacacttttccccggcctccagccggccttctgggcccggacaccggcaggcacacactcgtttctgcgccttggggacccggccgccaggtgcaggtccctaccaccctgccctgcagaatcgtctctagcaaatcagctgacacctggtacccgatgtcgctgaggcttctaacccctctcttgcaaagacggtgacttttttttttccaataaaatattttatgacacagtgggggggcttgatg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]