GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2024-04-25 16:46:46, GGRNA : RefSeq release 222 (Jan, 2024)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 341..523 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(341..343,350..352,485..487,494..499,506..508) /gene="HB-3" /locus_tag="AT2G33880" /gene...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1770 bp)
LOCUS NM_006562 1770 bp mRNA linear PRI 02-AUG-2023 DEFINITION Homo sapiens ladybird homeobox 1 (LBX1), mRNA. ACCESSION NM_006562 VERSION NM_006562.5 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL135794.19. This sequence is a reference standard in the RefSeqGene project. On Sep 30, 2020...
Synonym: CCHS3; homeobox; HPX-6; HPX6; LBX1H
NM_006562.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 53 (HB53), mRNA. (941 bp)
NA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox,...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9
NM_126068.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 3 (HB-3), mRNA. (1564 bp)
; HOMEOBOX PROTEIN" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 875..991 /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="Homeobox...
Synonym: ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN
NM_121519.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (876 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22" /inference="Similar to RNA sequence, EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1" /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1" /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22
NM_179935.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 4 (HB4), mRNA. (1394 bp)
gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 702..854 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature 858..989 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8
NM_130055.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (1018 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /inference="Similar to RNA sequence, EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1, INSD:DR751539.1" /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1" /note="homeobox-leucine zipper protein 17 (HB17); FUNCTIONS IN: sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_126204.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (2359 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..2359 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene <1..2359 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /db_xref="Araport:AT2G01430" /db_xref="GeneID:814671" /db_xref="TAIR:AT2G01430" CDS 1..642 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_001335062.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 21 (HB21), mRNA. (1058 bp)
INSD:DR750746.1,INSD:DR750857.1,INSD:DR750745.1" /inference="similar to RNA sequence, mRNA:INSD:BT031362.1,INSD:BT031368.1" /note="homeobox protein 21 (HB21); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Helix-turn-helix motif, lambda...
Synonym: ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2
NM_127411.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1308 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(270..272,279..281,399..401,408..413,420..422) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 279..431 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6
NM_001036473.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 22-MAY-2022 DEFINITION Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript...
Synonym: GRMZM2G136369; homeobox1; hox1a; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), mRNA. (1365 bp)
gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 866..1042 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(866..868,875..877,1010..1012,1019..1024,1031..1033) /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19;...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_001332460.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (866 bp)
gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 280..456 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(280..282,289..291,424..426,433..438,445..447) /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_001332461.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 3 (HAT3), mRNA. (1447 bp)
locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(775..777,784..786,904..906,913..918,925..927) /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 784..936 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3
NM_115903.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1474 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(288..290,297..299,417..419,426..431,438..440) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 297..449 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6
NM_130233.5 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (826 bp)
xref="GeneID:838660" /db_xref="TAIR:AT1G20700" CDS 1..636 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /inference="Similar to RNA sequence, EST:INSD:DR751559.1,INSD:AA585837.1,INSD:T22843.1, INSD:DR751560.1" /inference="similar to RNA sequence, mRNA:INSD:AJ441297.1" /note="WUSCHEL related homeobox 14 (WOX14); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: WUSCHEL...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_101922.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 12 (HB-12), mRNA. (1054 bp)
." /codon_start=1 /product="homeobox 12" /protein_id="NP_191748.1" /db_xref="GeneID:825362" /db_xref="TAIR:AT3G61890" /db_xref="Araport:AT3G61890" /translation="MEEGDFFNCCFSEISSGMTMNKKKMKKSNNQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQRLNEEMQRPKEEKHHECCGDQGLALSSSTESHNGKSEPEGRLDQGSVLCNDGDYNNNIKTEYFGFEEETDHELMNIVEKADDSCLTSSENWGGFNSDSLLDQSSSNYPNWWEFWS" misc_feature 251..403 /gene="HB-12" /locus_tag="AT3G61890" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12
NM_116054.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 25-FEB-2022 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000220.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana WUSCHEL related homeobox 8 (WOX8), mRNA. (1151 bp)
db_xref="TAIR:AT5G45980" CDS 36..1013 /gene="WOX8" /locus_tag="AT5G45980" /gene_synonym="MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B" /inference="Similar to RNA sequence, EST:INSD:DR750890.1,INSD:AV557790.1,INSD:DR750889.1, INSD:AV556647.1" /inference="similar to RNA sequence, mRNA:INSD:AY251400.1" /note="WUSCHEL related homeobox 8 (WOX8); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: homeobox-3 (TAIR:AT2G33880.1); Has 568 Blast hits to 538...
Synonym: MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B
NM_123966.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X1, mRNA. (2580 bp)
LOCUS XM_039103065 2580 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X1, mRNA. ACCESSION XM_039103065 VERSION XM_039103065.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
Synonym: Isl-1; isl-1=homeobox
XM_039103065.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X2, mRNA. (1414 bp)
LOCUS XM_039103066 1414 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X2, mRNA. ACCESSION XM_039103066 VERSION XM_039103066.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
Synonym: Isl-1; isl-1=homeobox
XM_039103066.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 18-APR-2023 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana WUSCHEL related homeobox 10 (WOX10), partial mRNA. (594 bp)
db_xref="TAIR:AT1G20710" CDS 1..594 /gene="WOX10" /locus_tag="AT1G20710" /gene_synonym="F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B" /note="WUSCHEL related homeobox 10 (WOX10); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is:...
Synonym: F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B
NM_101923.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 5 (WOX5), mRNA. (1052 bp)
WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /note="Arabidopsis thaliana WOX5 protein mRNA" /db_xref="Araport:AT3G11260" /db_xref="GeneID:820297" /db_xref="TAIR:AT3G11260" CDS 327..875 /gene="WOX5" /locus_tag="AT3G11260" /gene_synonym="WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /inference="Similar to RNA sequence, EST:INSD:DR750862.1,INSD:DR751206.1,INSD:DR750861.1, INSD:EH977836.1" /inference="Similar to RNA sequence, mRNA:INSD:AY150812.1,INSD:AY251398.1" /note="WUSCHEL related homeobox 5 (WOX5); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356),...
Synonym: WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B
NM_111961.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 7 (WOX7), partial mRNA. (429 bp)
TAIR:AT5G05770" CDS 61..429 /gene="WOX7" /locus_tag="AT5G05770" /gene_synonym="MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related homeobox 5A; WUSCHEL related homeobox 7" /inference="Similar to RNA sequence, EST:INSD:DR750916.1,INSD:DR751352.1,INSD:DR750917.1" /note="WUSCHEL related homeobox 7 (WOX7); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: WUSCHEL related...
Synonym: MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related homeobox 5A; WUSCHEL related homeobox 7
NM_120659.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
2; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="propagated from UniProtKB/Swiss-Prot (Q804R0.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Caenorhabditis elegans Homeobox-cysteine loop-homeobox domain-containing protein (ceh-92), mRNA. (2444 bp)
LOCUS NM_067096 2444 bp mRNA linear INV 22-NOV-2023 DEFINITION Caenorhabditis elegans Homeobox-cysteine loop-homeobox domain-containing protein (ceh-92), mRNA. ACCESSION NM_067096 VERSION NM_067096.4 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence...
NM_067096.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Arabidopsis thaliana homeobox protein 25 (HB25), mRNA. (1553 bp)
chromosome="5" /ecotype="Columbia" gene 1..1553 /gene="HB25" /locus_tag="AT5G65410" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 25; ATHB25; homeobox protein 25; MNA5.14; MNA5_14; ZFHD2; ZHD1; ZINC FINGER HOMEODOMAIN 1; ZINC FINGER HOMEODOMAIN 2" /note="Encodes ZFHD2, a member of the zinc...IN: intracellular; EXPRESSED IN: 14 plant structures; EXPRESSED DURING: 9 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox domain, ZF-HD class (InterPro:IPR006455), ZF-HD homeobox protein, Cys/His-rich dimerisation domain (InterPro:IPR006456), Zinc finger, C2H2-type (InterPro:IPR007087),...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 25; ATHB25; homeobox protein 25; MNA5.14; MNA5_14; ZFHD2; ZHD1; ZINC FINGER HOMEODOMAIN 1; ZINC FINGER HOMEODOMAIN 2
NM_125939.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="propagated from UniProtKB/Swiss-Prot (Q01703.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Arabidopsis thaliana homeobox protein 2 (HB-2), mRNA. (1333 bp)
ecotype="Columbia" gene 1..1333 /gene="HB-2" /locus_tag="AT4G16780" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 2; ATHB-2; ATHB2; DL4415W; FCAALL.101; HAT4; homeobox protein 2" /note="Encodes a homeodomain-leucine zipper protein that is rapidly and strongly induced by changes in the ratio...INSD:AF375453.1,INSD:X68145.1, INSD:AY081747.1" /note="homeobox protein 2 (HB-2); CONTAINS InterPro DOMAIN/s: HD-ZIP protein, N-terminal (InterPro:IPR006712), Helix-turn-helix motif, lambda-like repressor (InterPro:IPR000047), Homeobox (InterPro:IPR001356), Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 2; ATHB-2; ATHB2; DL4415W; FCAALL.101; HAT4; homeobox protein 2
NM_117780.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (583 bp)
LOCUS NR_131758 583 bp RNA linear ROD 05-AUG-2023 DEFINITION Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_131758 VERSION NR_131758.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT PREDICTED REFSEQ: This record has not been reviewed and the function is unknown. The reference sequence was derived from AK002860.1. ##Evidence-...
Synonym: 0610040B09Rik; Hoxb5/6as
NR_131758.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox protein knotted-1-like 3 (KNAT3), mRNA. (1891 bp)
KNAT3 HOMEOBOX PROTEIN; KNOTTED1-like homeobox gene 3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(1173..1175,1182..1184,1311..1313,1320..1325, 1332..1334) /gene="KNAT3" /locus_tag="AT5G25220" /gene_synonym="F21J6.18; F21J6_18; KNAT3 HOMEOBOX PROTEIN; KNOTTED1-like homeobox gene 3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1221..1337 /gene="KNAT3" /locus_tag="AT5G25220" /gene_synonym="F21J6.18; F21J6_18; KNAT3 HOMEOBOX PROTEIN; KNOTTED1-like homeobox gene 3" /note="Homeobox KN domain; Region...
Synonym: F21J6.18; F21J6_18; KNAT3 HOMEOBOX PROTEIN; KNOTTED1-like homeobox gene 3
NM_001036861.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
PREDICTED: Xenopus laevis pituitary homeobox 3-like [provisional] L homeolog (homeobox100496651-provisional.L), mRNA. (1350 bp)
LOCUS XM_018225529 1350 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis pituitary homeobox 3-like [provisional] L homeolog (homeobox100496651-provisional.L), mRNA. ACCESSION XM_018225529 VERSION XM_018225529.2 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_018225529.2 - Xenopus laevis (African clawed frog) - NCBI
Arabidopsis thaliana homeobox protein 22 (HB22), partial mRNA. (820 bp)
incomplete on the 3' end. FEATURES Location/Qualifiers source 1..820 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="4" /ecotype="Columbia" gene 1..>820 /gene="HB22" /locus_tag="AT4G24660" /gene_synonym="ATHB22; F22K18.140; F22K18_140; homeobox protein 22; HOMEOBOX PROTEIN 22; MATERNAL EFFECT EMBRYO ARREST 68; MEE68; ZHD2; ZINC FINGER HOMEODOMAIN 2" /db_xref="Araport:AT4G24660" /db_xref="GeneID:828568" /db_xref="TAIR:AT4G24660" CDS 125..820 /gene="HB22" /locus_tag="AT4G24660" /gene_synonym="ATHB22; F22K18.140; F22K18_140; homeobox protein 22; HOMEOBOX...
Synonym: ATHB22; F22K18.140; F22K18_140; homeobox protein 22; HOMEOBOX PROTEIN 22; MATERNAL EFFECT EMBRYO ARREST 68; MEE68; ZHD2; ZINC FINGER HOMEODOMAIN 2
NM_001341690.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (1284 bp)
chromosome="4" /ecotype="Columbia" gene 1..1284 /gene="HB22" /locus_tag="AT4G24660" /gene_synonym="ATHB22; F22K18.140; F22K18_140; homeobox protein 22; HOMEOBOX PROTEIN 22; MATERNAL EFFECT EMBRYO ARREST 68; MEE68; ZHD2; ZINC FINGER HOMEODOMAIN 2" /db_xref="Araport:AT4G24660" /db_xref="GeneID...INSD:BP818692.1,INSD:EH946790.1" /inference="Similar to RNA sequence, mRNA:INSD:AF439841.1,INSD:AY125563.1" /note="homeobox protein 22 (HB22); CONTAINS InterPro DOMAIN/s: Homeobox domain, ZF-HD class (InterPro:IPR006455), ZF-HD homeobox protein, Cys/His-rich dimerisation domain...
Synonym: ATHB22; F22K18.140; F22K18_140; homeobox protein 22; HOMEOBOX PROTEIN 22; MATERNAL EFFECT EMBRYO ARREST 68; MEE68; ZHD2; ZINC FINGER HOMEODOMAIN 2
NM_118599.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein knotted-1-like 3 (KNAT3), mRNA. (2046 bp)
KNAT3 HOMEOBOX PROTEIN; KNOTTED1-like homeobox gene 3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(1303..1305,1312..1314,1441..1443,1450..1455, 1462..1464) /gene="KNAT3" /locus_tag="AT5G25220" /gene_synonym="F21J6.18; F21J6_18; KNAT3 HOMEOBOX PROTEIN; KNOTTED1-like homeobox gene 3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1351..1467 /gene="KNAT3" /locus_tag="AT5G25220" /gene_synonym="F21J6.18; F21J6_18; KNAT3 HOMEOBOX PROTEIN; KNOTTED1-like homeobox gene 3" /note="Homeobox KN domain; Region...
Synonym: F21J6.18; F21J6_18; KNAT3 HOMEOBOX PROTEIN; KNOTTED1-like homeobox gene 3
NM_122431.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Xenopus laevis UNC homeobox L homeolog (uncx.L), mRNA. (2120 bp)
uncx; uncx-4.1; uncx4.1; uncx4.1.2" /note="Unc4.1 homeobox, gene 2; UNC homeobox transcription factor" /codon_start=1 /product="UNC homeobox L homeolog" /protein_id="NP_001080642.1" /db_xref="GeneID:380334" /db_xref="Xenbase:XB-GENE-920204" /translation="MMESRILEHPHAQFGGSMSGMVSFPYPLGHHHVYELASHQLQSAAAAVPFSIDGLLNGSCTASVVNPTPLMHSGCGLGGDSHQYKLSDSGDPDKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVQSSPLPMYALYSLYIE" misc_feature 600..737 /gene="uncx.L" /gene_synonym="uncx; uncx-4.1; uncx4.1; uncx4.1.2" /note="homeobox; Region: Homeobox domain" misc_feature 606..>737 /gene="uncx.L" /gene_...
Synonym: uncx; uncx-4.1; uncx4.1; uncx4.1.2
NM_001087173.1 - Xenopus laevis (African clawed frog) - NCBI
Arabidopsis thaliana homeobox protein 21 (HB21), mRNA. (1223 bp)
INSD:EG441193.1,INSD:EG441801.1,INSD:EG441148.1, INSD:EG441818.1,INSD:DR368557.1,INSD:EG441189.1, INSD:EG441802.1,INSD:EG441800.1,INSD:EG441807.1, INSD:EG441803.1,INSD:EG441163.1" /inference="similar to RNA sequence, mRNA:INSD:AY773834.1,INSD:AY091515.1" /note="homeobox protein 21 (HB21); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeobox domain, ZF-HD class (InterPro:IPR006455), ZF-HD homeobox protein, Cys/His-rich dimerisation domain (InterPro:IPR006456), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: homeobox protein 31...
Synonym: ATHB21; homeobox protein 21; T8K22.16; T8K22_16; ZFHD4; ZHD3; ZINC FINGER HOMEODOMAIN 3; ZINC FINGER HOMEODOMAIN 4
NM_001335126.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 24 (HB24), mRNA. (1065 bp)
EG516460.1, INSD:CB256827.1,INSD:ES117665.1,INSD:ES195904.1, INSD:ES115719.1" /inference="similar to RNA sequence, mRNA:INSD:AY088255.1" /note="homeobox protein 24 (HB24); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription; LOCATED IN: cellular_component unknown; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 12 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox domain, ZF-HD class (InterPro:IPR006455), ZF-HD homeobox protein, Cys/His-rich dimerisation domain (InterPro:IPR006456), Homeodomain-related...
Synonym: AtHB24; homeobox protein 24; T30D6.14; T30D6_14; ZHD6; ZINC FINGER HOMEODOMAIN 6
NM_127392.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 21 (HB21), mRNA. (1404 bp)
LOCUS NM_126310 1404 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana homeobox protein 21 (HB21), mRNA. ACCESSION NM_126310 VERSION NM_126310.3 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This...
Synonym: ATHB21; homeobox protein 21; T8K22.16; T8K22_16; ZFHD4; ZHD3; ZINC FINGER HOMEODOMAIN 3; ZINC FINGER HOMEODOMAIN 4
NM_126310.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
PREDICTED: Xenopus tropicalis pituitary homeobox 3-like [provisional] (homeobox100496651-provisional), mRNA. (1234 bp)
LOCUS XM_002941764 1234 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis pituitary homeobox 3-like [provisional] (homeobox100496651-provisional), mRNA. ACCESSION XM_002941764 VERSION XM_002941764.5 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_002941764.5 - Xenopus tropicalis (tropical clawed frog) - NCBI
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
LOCUS NM_205533 1018 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus H6 family homeobox 1 (HMX1), mRNA. ACCESSION NM_205533 VERSION NM_205533.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...synonym="GH6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_...
Synonym: GH6
NM_205533.3 - Gallus gallus (chicken) - NCBI - UCSC
Strongyloides ratti Homeobox domain and Homeobox KN domain and Homeodomain-like-containing protein (SRAE_2000258700), partial mRNA. (1398 bp)
LOCUS XM_024653672 1398 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Homeobox domain and Homeobox KN domain and Homeodomain-like-containing protein (SRAE_2000258700), partial mRNA. ACCESSION XM_024653672 VERSION XM_024653672.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to...
XM_024653672.1 - Strongyloides ratti - NCBI
Arabidopsis thaliana Homeobox-leucine zipper protein family (ATHB54), mRNA. (1269 bp)
synonym="HB54; homeobox protein 54" /note="Encodes ATHB54, a member of the homeodomain leucine zipper (HD-Zip) family protein. Please note that this locus was split from AT1G27050 in the TAIR10 genome release (2010). Affymetrix ATH1 Probe Set linked to symbol ATHB54 is in fact directed against the product of the AT1G27050 locus (the mRNA coding for the RNA-recognition-motif protein)." /db_xref="Araport:AT1G27045" /db_xref="GeneID:10723019" /db_xref="TAIR:AT1G27045" CDS 285..968 /gene="ATHB54" /locus_tag="AT1G27045" /gene_synonym="HB54; homeobox protein 54" /note="Homeobox-leucine zipper...
Synonym: HB54; homeobox protein 54
NM_001198174.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (892 bp)
LOCUS NM_204990 892 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. ACCESSION NM_204990 VERSION NM_204990.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 194..355 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(194..196,203..205,323..325,332..337,344..346) /gene="MIXL1" /gene_synonym="...
Synonym: CMIX
NM_204990.2 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox 1 (HB-1), mRNA. (1440 bp)
gene="HB-1" /locus_tag="AT3G01470" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 1; ATHB-1; ATHB1; F4P13.2; F4P13_2; HAT5; HD-ZIP-1; homeobox 1; HOMEODOMAIN PROTEIN FROM ARABIDOIPSIS THALIANA 5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 736..861 /gene="HB-1" /locus_tag="AT3G01470" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 1; ATHB-1; ATHB1; F4P13.2; F4P13_2; HAT5; HD-ZIP-1; homeobox 1; HOMEODOMAIN PROTEIN FROM ARABIDOIPSIS THALIANA 5" /note="Homeobox associated leucine zipper; Region: HALZ; pfam02183" /db_xref="CDD:426641" ORIGIN...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 1; ATHB-1; ATHB1; F4P13.2; F4P13_2; HAT5; HD-ZIP-1; homeobox 1; HOMEODOMAIN PROTEIN FROM ARABIDOIPSIS THALIANA 5
NM_111013.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-leucine zipper protein 18 (HB18), mRNA. (1099 bp)
inference="similar to RNA sequence, mRNA:INSD:AK118149.1,INSD:BT005594.1,INSD:AK175965.1, INSD:AK175837.1" /note="homeobox-leucine zipper protein 18 (HB18); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus, chloroplast; EXPRESSED IN: hypocotyl, root, flower; EXPRESSED DURING: 4 anthesis; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Leucine zipper,...
Synonym: ATHB18; F15H11.30; homeobox-leucine zipper protein 18
NM_105760.6 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Capra hircus msh homeobox 2 (MSX2), mRNA. (804 bp)
msh homeobox 2" /protein_id="NP_001272530.1" /db_xref="GeneID:100861257" /translation="MASPSKGNDLSSSDEEGPAMVAGPGPGPGGVEGAAEERSIKVSSLPFSVEALMSDKKPPKETSPRPAESASAWATLRPLLQPGHGVREAHSPGPLVKPFETASVKSENSKDGAAWMQEPGRCSPLPRHMSPTTCTLRKHKSNRKPRTPFTTSQLLALEREFRQKQHLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRPQEAELEKLKLAAKPMLPWGFSLPCPINSPLQAASLYGASYPFHRPVLPIPPVGLHATPVGYGMHHLS" misc_feature order(427..441,445..447,496..498,514..516,553..555, 559..564,571..576,580..588,592..597) /gene="MSX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain;...
NM_001285601.1 - Capra hircus (goat) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/homeobox
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.284 | 0.284 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.522 | 0.238 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.532 | 0.010 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]