GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2020-04-07 23:05:59, GGRNA : RefSeq release 99 (Mar, 2020)



Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Xenopus tropicalis pituitary homeobox 3-like [provisional] (homeobox100496651-provisional), mRNA. (1234 bp)
LOCUS XM_002941764 1234 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis pituitary homeobox 3-like [provisional] (homeobox100496651-provisional), mRNA. ACCESSION XM_002941764 VERSION XM_002941764.5 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_002941764.5 - Xenopus tropicalis (tropical clawed frog) - NCBI
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 25-DEC-2019 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1;...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 328..1018 /gene="HMX1" /gene_synonym="GH6" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL...
Synonym: GH6
NM_205533.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox A5 (HOXA5), mRNA. (1191 bp)
Synonym: HOX1.3; HOX1C
NM_001318419.1 - Gallus gallus (chicken) - NCBI - UCSC
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..379 /gene="MSX2" /inference="alignment:Splign:2.1.0" exon 380..804 /gene="MSX2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Gallus gallus msh homeobox 2 (MSX2), mRNA. (1107 bp)
LOCUS NM_204559 1107 bp mRNA linear VRT 22-DEC-2019 DEFINITION Gallus gallus msh homeobox 2 (MSX2), mRNA. ACCESSION NM_204559 VERSION NM_204559.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 510..671 /gene="MSX2" /gene_synonym="HOX-8; Msx-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(510..512,519..521,639..641,648..653,660..662) /gene="MSX2" /gene_synonym="...
Synonym: HOX-8; Msx-2
NM_204559.1 - Gallus gallus (chicken) - NCBI - UCSC
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Bos taurus retina and anterior neural fold homeobox 2 (RAX2), mRNA. (1828 bp)
gene="RAX2" /gene_synonym="QRX" /note="Region: homeobox domain" misc_feature order(130..144,148..150,199..201,217..219,256..258, 262..267,274..279,283..291,295..300) /gene="RAX2" /gene_synonym="QRX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(136..138,145..147,265..267,274..279,286..288) /gene="RAX2" /gene_synonym="QRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 139..297 /gene="RAX2" /gene_synonym="QRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
Synonym: QRX
NM_182653.1 - Bos taurus (cattle) - NCBI
Gallus gallus homeobox D13 (HOXD13), mRNA. (1964 bp)
LOCUS NM_205434 1964 bp mRNA linear VRT 26-DEC-2019 DEFINITION Gallus gallus homeobox D13 (HOXD13), mRNA. ACCESSION NM_205434 XM_429309 VERSION NM_205434.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 719..880 /gene="HOXD13" /gene_synonym="chox-4.8; chox-4G" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(719..721,728..730,848..850,857..862,869..871) /gene="HOXD13" /gene_...
Synonym: chox-4.8; chox-4G
NM_205434.1 - Gallus gallus (chicken) - NCBI - UCSC
Papio anubis homeobox A1 (HOXA1), mRNA. (1008 bp)
NM_001169063.1 - Papio anubis (olive baboon) - NCBI
Ovis aries homeobox C6 (HOXC6), mRNA. (1196 bp)
LOCUS NM_001009335 1196 bp mRNA linear MAM 24-DEC-2019 DEFINITION Ovis aries homeobox C6 (HOXC6), mRNA. ACCESSION NM_001009335 VERSION NM_001009335.1 KEYWORDS RefSeq. SOURCE Ovis aries (sheep) ORGANISM Ovis aries Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria;...HOXC6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 199..360 /gene="HOXC6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:333795" ORIGIN //...
NM_001009335.1 - Ovis aries (sheep) - NCBI
Gallus gallus caudal type homeobox 4 (CDX4), mRNA. (1453 bp)
ox-cad2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 524..669 /gene="CDX4" /gene_synonym="CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" exon 670..1445 /gene="CDX4" /gene_synonym="CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1453) AUTHORS Joshi P, Darr AJ and Skromne I. TITLE CDX4 regulates the progression of neural maturation in the spinal cord JOURNAL Dev. Biol. 449 (2), 132-142 (2019) PUBMED 30825428 REMARK GeneRIF: Results show that in the spinal cord, caudal type homeobox 4 (CDX4) is part...
Synonym: CDXB; CHOX-CAD2; ox-cad2
NM_204614.1 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus tropicalis H6 family homeobox 3 (hmx3), mRNA. (2200 bp)
LOCUS NM_001079361 2200 bp mRNA linear VRT 26-DEC-2019 DEFINITION Xenopus tropicalis H6 family homeobox 3 (hmx3), mRNA. ACCESSION NM_001079361 VERSION NM_001079361.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 763..924 /gene="hmx3" /gene_synonym="nkx-5.1; nkx5-1; nkx5.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(763..765,772..774,892..894,901..906,913..915) /gene="hmx3" /gene_...
Synonym: nkx-5.1; nkx5-1; nkx5.1
NM_001079361.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Gallus gallus homeobox D11 (HOXD11), mRNA. (1006 bp)
LOCUS NM_204620 1006 bp mRNA linear VRT 27-DEC-2019 DEFINITION Gallus gallus homeobox D11 (HOXD11), mRNA. ACCESSION NM_204620 XM_001234561 VERSION NM_204620.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...GHOX4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 709..870 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(709..711,718..720,838..840,847..852,859..861) /gene="HOXD11" /gene_...
Synonym: GHOX4.6
NM_204620.1 - Gallus gallus (chicken) - NCBI - UCSC
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Gallus gallus homeobox A6 (HOXA6), mRNA. (1467 bp)
LOCUS NM_001030987 1467 bp mRNA linear VRT 29-DEC-2019 DEFINITION Gallus gallus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001030987 XM_418729 VERSION NM_001030987.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 469..627 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..436 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /inference="alignment:...
Synonym: HOX1; HOX1.2; HOX1B
NM_001030987.2 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus tropicalis GS homeobox 1 (gsx1), mRNA. (1456 bp)
gsh-1; gsh1; Xgsh1" /note="Region: homeobox" misc_feature order(553..567,571..573,622..624,640..642,679..681, 685..690,697..702,706..714,718..723) /gene="gsx1" /gene_synonym="gsh-1; gsh1; Xgsh1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(559..561,568..570,688..690,697..702,709..711) /gene="gsx1" /gene_synonym="gsh-1; gsh1; Xgsh1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 562..720 /gene="gsx1" /gene_synonym="gsh-1; gsh1; Xgsh1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="...
Synonym: gsh-1; gsh1; Xgsh1
NM_001045789.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus tropicalis distal-less homeobox 3 (dlx3), mRNA. (1854 bp)
less homeo box 3" /codon_start=1 /product="homeobox protein DLX-3" /protein_id="NP_001025566.1" /db_xref="GeneID:594954" /db_xref="Xenbase:XB-GENE-5879293" /translation="MSGSYEKKMAVLTDLTTSCHPVTKDSPTLPESTATDMGYYSGHLSGGQHDFFQTQAYSPSISSYGYHHPHHQYNFNGLVGNESFLPKDDYQYGGGYRAFGHYREPPVPETVSVKEEPETEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKTGEGPGLEHSPNNSDSMACNSPSSPPVWDNSRSRTPSLPPCSSPSYMENYHPWYTQQTQPGQHLQPSEVMHQPPSNTVY" misc_feature 115..351 /gene="dlx3" /gene_synonym="ai4; dlx3-a; dlx3-b; tdo; Xdll-2; xdlx3" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N...
Synonym: ai4; dlx3-a; dlx3-b; tdo; Xdll-2; xdlx3
NM_001030395.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus tropicalis UNC homeobox (uncx), mRNA. (1479 bp)
misc_feature 312..491 /gene="uncx" /gene_synonym="uncx-4.1; uncx4.1" /note="Region: homeobox domain" misc_feature order(315..329,333..335,384..386,402..404,441..443, 447..452,459..464,468..476,480..485) /gene="uncx" /gene_synonym="uncx-4.1; uncx4.1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 321..482 /gene="uncx" /gene_synonym="uncx-4.1; uncx4.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(321..323,330..332,450..452,459..464,471..473) /gene="uncx" /gene_synonym="uncx-4.1; uncx4.1" /note="specific DNA base...
Synonym: uncx-4.1; uncx4.1
NM_001318744.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus tropicalis empty spiracles homeobox 1 (emx1), mRNA. (1377 bp)
gene="emx1" /note="empty spiracles homeobox 1, gene 2; empty spiracles homolog 1; empty spiracles-like protein 1" /codon_start=1 /product="homeobox protein EMX1" /protein_id="NP_001005459.1" /db_xref="GeneID:448058" /db_xref="Xenbase:XB-GENE-920144" /translation="MFQPAGKRCFTIESLVAKDNPLSSEEPLRPAALPYPGAPAEAFVSGFPSPAGRSLYNNPELVFPETVSHPPLTVHPHQLGASHLQHPHSFFAPQHRDPLNFYPWVLRNRFFGHRFQGGDVSQESLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLASSLSLSETQVKVWFQNRRTKYKRQKLEEEGPDSDQKKKGSHHINRWRLATKQPNGEDIDVTSND" misc_feature 462..>791 /gene="emx1" /note="Homeobox protein; Region: Abdominal-A; cl27820" /db_xref="...
NM_001005459.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Pan troglodytes homeobox B1 (HOXB1), mRNA. (906 bp)
LOCUS NM_001081572 906 bp mRNA linear PRI 25-DEC-2019 DEFINITION Pan troglodytes homeobox B1 (HOXB1), mRNA. ACCESSION NM_001081572 XM_001173083 VERSION NM_001081572.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="HOXB1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 619..777 /gene="HOXB1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(625..627,745..747,754..759,766..768) /gene="HOXB1" /note="specific DNA base contacts...
NM_001081572.1 - Pan troglodytes (chimpanzee) - NCBI
Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. (1144 bp)
LOCUS NM_010420 1144 bp mRNA linear ROD 20-OCT-2019 DEFINITION Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. ACCESSION NM_010420 VERSION NM_010420.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...Rpx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 689..850 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(689..691,698..700,818..820,827..832,839..841) /gene="Hesx1" /gene_...
Synonym: HES-1; Rpx
NM_010420.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox C8 (Hoxc8), mRNA. (1228 bp)
FEATURES Location/Qualifiers source 1..1228 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..1228 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox C8" /db_xref="GeneID:24460" /db_xref="RGD:2821" CDS 1..729 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox protein R4; Homeobox gene C8; homeo box C8" /codon_start=1 /product="homeobox protein Hox-C8" /protein_id="NP_001170797.2" /db_xref="GeneID:24460" /db_xref="RGD:2821" /translation="...
Synonym: Hox3r4
NM_001177326.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus msh homeobox 2 (Msx2), mRNA. (2162 bp)
LOCUS NM_013601 2162 bp mRNA linear ROD 25-FEB-2020 DEFINITION Mus musculus msh homeobox 2 (Msx2), mRNA. ACCESSION NM_013601 VERSION NM_013601.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;...binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 503..664 /gene="Msx2" /gene_synonym="BB122635; Hox-8; Hox8; Hox8.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(503..505,512..514,632..634,641..646,653..655) /gene="Msx2" /gene_...
Synonym: BB122635; Hox-8; Hox8; Hox8.1
NM_013601.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 08-OCT-2016 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AABR07030395.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H2.0-like homeobox (Hlx), mRNA. (2141 bp)
CDD:238039" misc_feature 1148..1309 /gene="Hlx" /gene_synonym="Hlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 906..1085 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" exon 1086..1270 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" exon 1271..2116 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" ORIGIN // REFERENCE 1 (bases 1 to 2141) AUTHORS Bates MD, Dunagan DT, Welch LC, Kaul A and Harvey RP. TITLE The Hlx homeobox transcription factor is required early in enteric nervous system development...
Synonym: Hlx1
NM_001077674.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Papio anubis homeobox A3 (HOXA3), mRNA. (1332 bp)
LOCUS NM_001169064 1332 bp mRNA linear PRI 21-NOV-2019 DEFINITION Papio anubis homeobox A3 (HOXA3), mRNA. ACCESSION NM_001169064 VERSION NM_001169064.1 KEYWORDS RefSeq. SOURCE Papio anubis (olive baboon) ORGANISM Papio anubis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia...HOXA3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 583..741 /gene="HOXA3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature 1129..1323 /gene="HOXA3" /note="Domain of unknown function (DUF4074); Region:...
NM_001169064.1 - Papio anubis (olive baboon) - NCBI
Macaca mulatta msh homeobox 1 (MSX1), mRNA. (1574 bp)
LOCUS NM_001040416 1574 bp mRNA linear PRI 23-OCT-2019 DEFINITION Macaca mulatta msh homeobox 1 (MSX1), mRNA. ACCESSION NM_001040416 VERSION NM_001040416.2 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi...gene="MSX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 770..931 /gene="MSX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(770..772,779..781,899..901,908..913,920..922) /gene="MSX1" /note="specific DNA base...
NM_001040416.2 - Macaca mulatta (Rhesus monkey) - NCBI
Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. (1845 bp)
LOCUS NM_205252 1845 bp mRNA linear VRT 26-DEC-2019 DEFINITION Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. ACCESSION NM_205252 VERSION NM_205252.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..686 /gene="HHEX" /gene_synonym="PROBOX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 469..647 /gene="HHEX" /gene_synonym="PROBOX" /inference="alignment:Splign:2.1.0" exon...
Synonym: PROBOX
NM_205252.1 - Gallus gallus (chicken) - NCBI - UCSC
Papio anubis homeobox A13 (HOXA13), mRNA. (621 bp)
codon_start=1 /product="homeobox protein Hox-A13" /protein_id="NP_001162372.1" /db_xref="GeneID:100137365" /translation="MGPHPNAIKSCAQPASFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS" misc_feature order(421..435,439..441,490..492,508..510,547..549, 553..558,565..570,574..582,586..591) /gene="HOXA13" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 427..588 /gene="HOXA13" /note="Homeobox domain; Region: Homeobox; pfam00046" /db...
NM_001168901.1 - Papio anubis (olive baboon) - NCBI
Papio anubis homeobox A7 (HOXA7), mRNA. (693 bp)
LOCUS NM_001168898 693 bp mRNA linear PRI 21-NOV-2019 DEFINITION Papio anubis homeobox A7 (HOXA7), mRNA. ACCESSION NM_001168898 VERSION NM_001168898.1 KEYWORDS RefSeq. SOURCE Papio anubis (olive baboon) ORGANISM Papio anubis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia...HOXA7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 400..561 /gene="HOXA7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:333795" exon 1..379 /gene="HOXA7" /inference="alignment:Splign:2.1.0" exon 380..693 /gene="HOXA7" /...
NM_001168898.1 - Papio anubis (olive baboon) - NCBI
Xenopus tropicalis homeobox C9 (hoxc9), mRNA. (896 bp)
="homeobox C9" /db_xref="GeneID:550010" /db_xref="Xenbase:XB-GENE-482330" misc_feature 83..85 /gene="hoxc9" /gene_synonym="hox3; hox3b; Xhoxc9; XlHbox6" /note="upstream in-frame stop codon" CDS 95..397 /gene="hoxc9" /gene_synonym="hox3; hox3b; Xhoxc9; XlHbox6" /codon_start=1 /product="homeobox C9" /protein_id="NP_001017256.1" /db_xref="GeneID:550010" /db_xref="Xenbase:XB-GENE-482330" /translation="MGEFLAPHGGKEGHLQLQKDNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKPDKEQS" misc_feature 197..337 /gene="hoxc9" /gene_synonym="hox3; hox3b; Xhoxc9; XlHbox6" /note="Homeobox...
Synonym: hox3; hox3b; Xhoxc9; XlHbox6
NM_001017256.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus tropicalis notochord homeobox (not), mRNA. (1523 bp)
LOCUS NM_001171198 1523 bp mRNA linear VRT 22-DEC-2019 DEFINITION Xenopus tropicalis notochord homeobox (not), mRNA. ACCESSION NM_001171198 VERSION NM_001171198.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata;...db_xref="CDD:238039" misc_feature 433..591 /gene="not" /gene_synonym="flh; not-a; not-b; not1; noto; Xnot; Xnot-2; Xnot1; Xnot2; Znot" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
Synonym: flh; not-a; not-b; not1; noto; Xnot; Xnot-2; Xnot1; Xnot2; Znot
NM_001171198.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Papio anubis homeobox A5 (HOXA5), mRNA. (813 bp)
LOCUS NM_001168897 813 bp mRNA linear PRI 21-NOV-2019 DEFINITION Papio anubis homeobox A5 (HOXA5), mRNA. ACCESSION NM_001168897 VERSION NM_001168897.1 KEYWORDS RefSeq. SOURCE Papio anubis (olive baboon) ORGANISM Papio anubis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia...HOXA5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 595..753 /gene="HOXA5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" exon 1..562 /gene="HOXA5" /inference="alignment:Splign:2.1.0" exon 563..813 /gene="HOXA5" /...
NM_001168897.1 - Papio anubis (olive baboon) - NCBI
Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. (1036 bp)
LOCUS NM_001129916 1036 bp mRNA linear VRT 22-DEC-2019 DEFINITION Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. ACCESSION NM_001129916 VERSION NM_001129916.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 427..585 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 296..546 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /inference="alignment:...
Synonym: vex1; Xvex-1
NM_001129916.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Sus scrofa homeobox A13 (HOXA13), mRNA. (645 bp)
product="homeobox protein Hox-A13" /protein_id="NP_001182271.1" /db_xref="GeneID:100359352" /db_xref="VGNC:VGNC:88936" /translation="MTASVLLHPRWIEPTVMFLYDNGGGLVAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAPGPYHHHQPVPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS" misc_feature order(445..459,463..465,514..516,532..534,571..573, 577..582,589..594,598..606,610..615) /gene="HOXA13" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 451..612 /gene="HOXA13" /note="Homeobox domain;...
NM_001195342.1 - Sus scrofa (pig) - NCBI
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 KEYWORDS RefSeq. SOURCE Takifugu rubripes (torafugu) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (torafugu) - NCBI
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Xenopus tropicalis NK2 homeobox 8 (nkx2-8), mRNA. (1505 bp)
nkx2h" /note="NK2 transcription factor related, locus 8" /codon_start=1 /product="homeobox protein Nkx-2.8" /protein_id="NP_988951.1" /db_xref="GeneID:394548" /db_xref="Xenbase:XB-GENE-853981" /translation="MSSGGLSFTVRRILGLPEFDSTAIQNDSPLNYTSRTPYQDWLDNERNHFLSSDDSGSETNSPDTTQRSEVGSDSAETEERRVLFSKAQTLELERRFRQQRYLSAPERDQLAHILHLTPTQVKIWFQNHRYKMKRVKPEASSTPPLLKRVMVPVLVRDGKPCQTCPSSPHSERESIQVLPTLHYNFFQGYPHHQQVAHPSSFSWRW" misc_feature 390..539 /gene="nkx2-8" /gene_synonym="nkx2-9; nkx2.8; nkx2h" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" ORIGIN // REFERENCE 1...
Synonym: nkx2-9; nkx2.8; nkx2h
NM_203620.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus tropicalis TGFB induced factor homeobox 1 (tgif1), mRNA. (2042 bp)
LOCUS NM_204051 2042 bp mRNA linear VRT 22-DEC-2019 DEFINITION Xenopus tropicalis TGFB induced factor homeobox 1 (tgif1), mRNA. ACCESSION NM_204051 VERSION NM_204051.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 456..575 /gene="tgif1" /gene_synonym="hpe4; tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:310480" ORIGIN // REFERENCE 1 (bases 1 to 2042) AUTHORS Klein SL, Strausberg RL, Wagner L...
Synonym: hpe4; tgif
NM_204051.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Rattus norvegicus homeo box B8 (Hoxb8), mRNA. (973 bp)
The reference sequence was derived from AABR07030395.1. On Jul 17, 2010 this sequence version replaced XM_220888.4. Summary: mouse homolog is a homeobox transcription factor; involved in control of developmental pathways [RGD, Feb 2006]. Sequence Note: The RefSeq transcript and protein were derived...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 448..609 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:333795" exon 1..424 /gene="Hoxb8" /gene_synonym="Hox2r1a" /inference="alignment:Splign:2.0.8" exon...
Synonym: Hox2r1a
NM_001191649.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis GS homeobox 2 (gsx2), mRNA. (1216 bp)
LOCUS NM_001017168 1216 bp mRNA linear VRT 22-DEC-2019 DEFINITION Xenopus tropicalis GS homeobox 2 (gsx2), mRNA. ACCESSION NM_001017168 VERSION NM_001017168.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 496..654 /gene="gsx2" /gene_synonym="gsh2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" regulatory 1140..1145 /regulatory_class="polyA_signal_sequence" /gene="gsx2" /gene_synonym="...
Synonym: gsh2
NM_001017168.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
sequence (NC_003071). FEATURES Location/Qualifiers source 1..1963 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene 1..1963 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Encodes a protein with similarity to WUS type homeodomain protein. Required for meristem growth and development and acts through positive regulation of WUS. Loss of function phenotypes include embryo lethality, hyponastic cotyledons, reduced...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Mus musculus msh homeobox 1 (Msx1), mRNA. (1931 bp)
LOCUS NM_010835 1931 bp mRNA linear ROD 18-FEB-2020 DEFINITION Mus musculus msh homeobox 1 (Msx1), mRNA. ACCESSION NM_010835 VERSION NM_010835.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;..." /db_xref="CDD:238039" misc_feature 775..936 /gene="Msx1" /gene_synonym="AA675338; AI324650; Hox-7; Hox7; Hox7.1; msh" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(775..777,784..786,904..906,913..918,925..927) /gene="Msx1" /gene_synonym="...
Synonym: AA675338; AI324650; Hox-7; Hox7; Hox7.1; msh
NM_010835.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis homeobox C8 (hoxc8), mRNA. (2285 bp)
LOCUS NM_001006786 2285 bp mRNA linear VRT 22-DEC-2019 DEFINITION Xenopus tropicalis homeobox C8 (hoxc8), mRNA. ACCESSION NM_001006786 VERSION NM_001006786.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata;...; other site" /db_xref="CDD:238039" misc_feature 832..990 /gene="hoxc8" /gene_synonym="hox3; hox3a; hoxc-8; xhoxc8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" ORIGIN // REFERENCE 1 (bases 1 to 2285) AUTHORS Klein SL, Strausberg RL, Wagner L, Pontius...
Synonym: hox3; hox3a; hoxc-8; xhoxc8
NM_001006786.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Sus scrofa NOBOX oogenesis homeobox (NOBOX), mRNA. (1768 bp)
LOCUS NM_001195116 1768 bp mRNA linear MAM 19-FEB-2020 DEFINITION Sus scrofa NOBOX oogenesis homeobox (NOBOX), mRNA. ACCESSION NM_001195116 VERSION NM_001195116.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;...gene="NOBOX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 597..758 /gene="NOBOX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(597..599,606..608,726..728,735..740,747..749) /gene="NOBOX" /note="specific DNA base...
NM_001195116.1 - Sus scrofa (pig) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.163 | 0.163 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.279 | 0.116 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.285 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]