GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2021-04-23 23:11:40, GGRNA : RefSeq release 205 (Mar, 2021)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Strongylocentrotus purpuratus homeobox (H-6 family) (HMX), mRNA. (1402 bp)
misc_feature order(881..895,899..901,950..952,968..970,1007..1009, 1013..1018,1025..1030,1034..1042,1046..1051) /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 887..1048 /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(887..889,896..898,1016..1018,1025..1030,1037..1039) /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1...
Synonym: homeobox; SpHmx
NM_214561.2 - Strongylocentrotus purpuratus (purple sea urchin) - NCBI
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 05-FEB-2021 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000220.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X2, mRNA. (1414 bp)
LOCUS XM_039103066 1414 bp mRNA linear ROD 21-JAN-2021 DEFINITION PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X2, mRNA. ACCESSION XM_039103066 VERSION XM_039103066.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
Synonym: Isl-1; isl-1=homeobox
XM_039103066.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X1, mRNA. (2580 bp)
LOCUS XM_039103065 2580 bp mRNA linear ROD 21-JAN-2021 DEFINITION PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X1, mRNA. ACCESSION XM_039103065 VERSION XM_039103065.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
Synonym: Isl-1; isl-1=homeobox
XM_039103065.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
PubMed:22406073" misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh; msh-; msh-C; mshC; msx; msx-; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh; msh-; msh-C; mshC; msx; msx-; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh; msh-; msh-C; mshC; msx; msx-;...
Synonym: homeobox; msh; msh-; msh-C; mshC; msx; msx-; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Gallus gallus homeobox A5 (HOXA5), mRNA. (1191 bp)
box 1C; homeo box A5; homeobox protein HOXA5; homeobox protein Hox-1C" /codon_start=1 /product="homeobox protein Hox-A5" /protein_id="NP_001305348.1" /db_xref="CGNC:66000" /db_xref="GeneID:100858404" /translation="MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQYRDSASMHSGRYGYGYNGMDLSVGRSASTHFGASERARTYPANSTSASTEPRYSQSAAASHSPPPDPLPCTAVAASPVSESHHGVKNSLGNSSSTSSNSSSSTHISRDGVGTSSGTEEDTPASSEQASAPSDQSTAQPSQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP" misc_feature 502..>822 /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="Homeobox protein; Region: Abdominal-A;...
Synonym: HOX1.3; HOX1C
NM_001318419.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. (636 bp)
organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="X" /map="Xq35" gene 1..636 /gene="Rhox5" /gene_synonym="Pem" /note="Rhox homeobox family member 5" /db_xref="GeneID:24631" /db_xref="RGD:3295" CDS 1..636 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.1" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="...
Synonym: Pem
NM_022175.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..379 /gene="MSX2" /inference="alignment:Splign:2.1.0" exon 380..804 /gene="MSX2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1770 bp)
misc_feature order(1024..1038,1042..1044,1093..1095,1111..1113, 1150..1152,1156..1161,1168..1173,1177..1185,1189..1194) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1030..1191 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1030..1032,1039..1041,1159..1161,1168..1173, 1180..1182) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H6 family homeobox 2 (Hmx2), mRNA. (1497 bp)
RGD1565366" /note="H6 homeo box 2" /codon_start=1 /product="homeobox protein HMX2" /protein_id="NP_001099773.1" /db_xref="GeneID:293538" /db_xref="RGD:1565366" /translation="MGSKEDVGKGCPAAGGVSSFTIQSILGGGPSEAPREPAGWPARKRSLSVSSEEEEPEEGWKAPACYCPDPHGPKEPSPKHHPPIPFPCLGTPKGSGGAGPAASERTPFLSPSHPDFKEEKERLLPAGSPSPGPERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQTLVGMPLVFRDSSLLRVPVPRSLAFPAPLYYPSSNLSALPLYNLYNKLDY" misc_feature 546..710 /gene="Hmx2" /gene_synonym="RGD1565366" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN //...
Synonym: RGD1565366
NM_001106303.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 9 (Rhox9), mRNA. (829 bp)
LOCUS NM_001024874 829 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus reproductive homeobox 9 (Rhox9), mRNA. ACCESSION NM_001024874 XM_216470 VERSION NM_001024874.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...Psx4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 468..629 /gene="Rhox9" /gene_synonym="Psx4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(468..470,477..479,597..599,606..611,618..620) /gene="Rhox9" /gene_synonym="...
Synonym: Psx4
NM_001024874.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Bos taurus retina and anterior neural fold homeobox 2 (RAX2), mRNA. (1828 bp)
gene="RAX2" /gene_synonym="QRX" /note="Region: homeobox domain" misc_feature order(130..144,148..150,199..201,217..219,256..258, 262..267,274..279,283..291,295..300) /gene="RAX2" /gene_synonym="QRX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(136..138,145..147,265..267,274..279,286..288) /gene="RAX2" /gene_synonym="QRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 139..297 /gene="RAX2" /gene_synonym="QRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
Synonym: QRX
NM_182653.1 - Bos taurus (cattle) - NCBI
Gallus gallus msh homeobox 1 (MSX1), mRNA. (1312 bp)
LOCUS NM_205488 1312 bp mRNA linear VRT 13-FEB-2021 DEFINITION Gallus gallus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_205488 XM_444660 VERSION NM_205488.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 569..730 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(569..571,578..580,698..700,707..712,719..721) /gene="MSX1" /gene_synonym...
Synonym: CHOX-7; GHOX-7; HOX-7
NM_205488.2 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Xenopus tropicalis pituitary homeobox 3-like [provisional] (homeobox100496651-provisional), mRNA. (1234 bp)
LOCUS XM_002941764 1234 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis pituitary homeobox 3-like [provisional] (homeobox100496651-provisional), mRNA. ACCESSION XM_002941764 VERSION XM_002941764.5 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_002941764.5 - Xenopus tropicalis (tropical clawed frog) - NCBI
Rattus norvegicus Rhox homeobox family member 7 (Rhox7), mRNA. (900 bp)
Rhox homeobox family member 7" /protein_id="NP_001020825.1" /db_xref="GeneID:298353" /db_xref="RGD:1563189" /translation="MWFSNRRAKERACEKKAMPRSIPGAKAQMILPAGEGRNGEESERSSPGQEASATKWGEVEELGERDRTGSDGENLSAVGTSGIRNDWDKEGASSSRQKNESRPQKPVPECRWGMEDVQPVPVLIPRVQRIQLVQSRVQSVPLKVPTPRIRPVAVSATTVQPEPVLVPRRHLHDRFTDPELQELERERVFQRNHYLSAEERKELARVMGVSEAKVQRWFKKRREHFRREQSQSGGAPPGNTPPLSEDGAGALVYHP" misc_feature order(520..522,646..648,655..660,667..669) /gene="Rhox7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..666 /gene="Rhox7" /note="Homeobox domain;...
NM_001025654.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Pan troglodytes HESX homeobox 1 (HESX1), mRNA. (558 bp)
codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_001075039.1" /db_xref="GeneID:747229" /db_xref="VGNC:VGNC:1836" /translation="MSPSLQEGAQLGESKPSTCSFSIERILGLDQNKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERALKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE" misc_feature order(325..339,343..345,394..396,412..414,451..453, 457..462,469..474,478..486,490..495) /gene="HESX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 331..492 /gene="HESX1" /note="Homeobox domain; Region: Homeobox...
NM_001081570.1 - Pan troglodytes (chimpanzee) - NCBI
Rattus norvegicus reproductive homeobox 8 (Rhox8), mRNA. (738 bp)
LOCUS NM_001025776 738 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus reproductive homeobox 8 (Rhox8), mRNA. ACCESSION NM_001025776 XM_578961 VERSION NM_001025776.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...Rhox8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 361..519 /gene="Rhox8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..64 /gene="Rhox8" /inference="alignment:Splign:2.0.8" exon 65..440 /gene="Rhox8" /...
NM_001025776.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. (894 bp)
LOCUS NM_205015 894 bp mRNA linear VRT 05-DEC-2020 DEFINITION Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. ACCESSION NM_205015 XM_429269 VERSION NM_205015.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...TLX-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 511..672 /gene="TLX1" /gene_synonym="TLX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(511..513,520..522,640..642,649..654,661..663) /gene="TLX1" /gene_synonym="...
Synonym: TLX-1
NM_205015.1 - Gallus gallus (chicken) - NCBI - UCSC
Canis lupus familiaris cone-rod homeobox (CRX), mRNA. (3299 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 592..849 /gene="CRX" /note="Otx1 transcription factor; Region: TF_Otx; pfam03529" /db_xref="CDD:281521" exon 203..354 /gene="CRX" /inference="alignment:Splign:2.1.0" exon 355..3289 /gene="CRX" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 3299) AUTHORS Akhmedov NB, Baldwin VJ, Zangerl B, Kijas JW, Hunter L, Minoofar KD, Mellersh C, Ostrander EA, Acland GM, Farber DB and Aguirre GD. TITLE Cloning and characterization of the canine photoreceptor specific cone-rod homeobox (CRX) gene and...
NM_001003049.1 - Canis lupus familiaris (dog) - NCBI
Oncorhynchus mykiss caudal-type homeobox protein 1 (cdx1), mRNA. (1497 bp)
cdx1" /inference="non-experimental evidence, no additional details recorded" /note="Region: homeobox" misc_feature order(545..556,560..562,611..613,629..631,668..670, 674..679,686..691,695..703,707..712) /gene="cdx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(548..550,557..559,677..679,686..691,698..700) /gene="cdx1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 551..709 /gene="cdx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 563..607 /gene="cdx1" /...
NM_001124632.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Rattus norvegicus H6 family homeobox 3 (Hmx3), mRNA. (1362 bp)
box 3" /codon_start=1 /product="homeobox protein HMX3" /protein_id="NP_001099772.1" /db_xref="GeneID:293537" /db_xref="RGD:1559927" /translation="MPEPGPDASGTASAPPPQPPPQPPAPKESPFSIRNLLNGDHHRPPPKPQPPPRTLFAPASKGALEGAAGFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPYTLTPAGGHLPRPEASEKALLRDSSPASGTDRDSPDPLLKADPDHKELDSKSPDEIILEESDSEEGKKEGEAVPGAAGTTVGATAATPGSEDWKAGADSPEKKPACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAAELEAANLSHAAAQRIVRVPILYHENSAAEGGAPVPVSQPLLTFPHPVYYSHPVVSSVPLLRPV" misc_feature 688..852 /gene="Hmx3" /gene_synonym="RGD1559927" /note="Homeobox domain; Region: Homeobox;...
Synonym: RGD1559927
NM_001106302.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 10 (Rhox10), mRNA. (606 bp)
LOCUS NM_001037581 606 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus reproductive homeobox 10 (Rhox10), mRNA. ACCESSION NM_001037581 VERSION NM_001037581.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 295..444 /gene="Rhox10" /gene_synonym="Rhoxf10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..365 /gene="Rhox10" /gene_synonym="Rhoxf10" /inference="alignment:Splign:2.0.8"...
Synonym: Rhoxf10
NM_001037581.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox C8 (Hoxc8), mRNA. (1228 bp)
FEATURES Location/Qualifiers source 1..1228 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..1228 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox C8" /db_xref="GeneID:24460" /db_xref="RGD:2821" CDS 1..729 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox protein R4; Homeobox gene C8; homeo box C8" /codon_start=1 /product="homeobox protein Hox-C8" /protein_id="NP_001170797.2" /db_xref="GeneID:24460" /db_xref="RGD:2821" /translation="...
Synonym: Hox3r4
NM_001177326.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box B8 (Hoxb8), mRNA. (973 bp)
gene_synonym="Hox2r1a" /note="Hox2.4 homeobox homolog; homeobox gene B8; homeobox protein R1a" /codon_start=1 /product="homeobox protein Hox-B8" /protein_id="NP_001178578.1" /db_xref="GeneID:24457" /db_xref="RGD:1586211" /translation="MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKEKLERAPETAEQGDAQKGDKK" misc_feature 448..609 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Hox2r1a
NM_001191649.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Homo sapiens double homeobox 5 (DUX5), mRNA. (594 bp)
DUX5" /gene_synonym="DUX1" /note="double homeobox protein; alternative translation start site; double homeobox protein 1" /codon_start=1 /product="double homeobox protein 5" /protein_id="NP_036281.2" /db_xref="GeneID:26581" /db_xref="HGNC:HGNC:3083" /db_xref="MIM:611444" /translation="MPAEVHGSPPASLCPCQSVKFRPGLPEMALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHRGQSGRAPTQASIRCNAAPIG" misc_feature 160..297 /gene="DUX5" /gene_synonym="DUX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: DUX1
NM_012149.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Canis lupus familiaris pancreatic and duodenal homeobox 1 (PDX1), mRNA. (1496 bp)
IPF1; PDX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(540..542,549..551,669..671,678..683,690..692) /gene="PDX1" /gene_synonym="IPF1; PDX-1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 502..1483 /gene="PDX1" /gene_synonym="IPF1; PDX-1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1496) AUTHORS Takemitsu H, Yamamoto I, Lee P, Ohta T, Mori N and Arai T. TITLE cDNA cloning and mRNA expression of canine pancreatic and duodenum homeobox 1 (Pdx-1) JOURNAL Res Vet Sci...
Synonym: IPF1; PDX-1
NM_001284471.2 - Canis lupus familiaris (dog) - NCBI
Macaca mulatta distal-less homeobox 1 (DLX1), mRNA. (2366 bp)
upstream in-frame stop codon" CDS 200..967 /gene="DLX1" /codon_start=1 /product="homeobox protein DLX-1" /protein_id="NP_001247548.1" /db_xref="GeneID:695620" /db_xref="VGNC:VGNC:104521" /translation="MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM" misc_feature 590..754 /gene="DLX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 513..712 /gene="DLX1" /...
NM_001260619.1 - Macaca mulatta (Rhesus monkey) - NCBI
Rattus norvegicus homeo box A2 (Hoxa2), mRNA. (1634 bp)
Hoxa-2; Hoxa11; RATHOX111A" /inference="alignment:Splign:2.0.8" misc_feature 53..55 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; RATHOX111A" /note="upstream in-frame stop codon" CDS 158..1276 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; RATHOX111A" /note="Homeobox gene A11; Homeobox gene A2; homeobox protein Hox-1.11" /codon_start=1 /product="homeobox protein Hox-A2" /protein_id="NP_036713.2" /db_xref="GeneID:103690123" /db_xref="RGD:2813" /translation="...
Synonym: hox-1.11; Hoxa-2; Hoxa11; RATHOX111A
NM_012581.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Macaca mulatta msh homeobox 1 (MSX1), mRNA. (1574 bp)
LOCUS NM_001040416 1574 bp mRNA linear PRI 15-DEC-2020 DEFINITION Macaca mulatta msh homeobox 1 (MSX1), mRNA. ACCESSION NM_001040416 VERSION NM_001040416.2 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi...gene="MSX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 770..934 /gene="MSX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order(770..772,779..781,899..901,908..913,920..922) /gene="MSX1" /note="specific DNA base...
NM_001040416.2 - Macaca mulatta (Rhesus monkey) - NCBI
Rattus norvegicus LIM homeobox 5 (Lhx5), mRNA. (1890 bp)
LOCUS NM_139036 1890 bp mRNA linear ROD 04-FEB-2021 DEFINITION Rattus norvegicus LIM homeobox 5 (Lhx5), mRNA. ACCESSION NM_139036 VERSION NM_139036.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...domain of Lhx1 (also known as Lim1) and Lhx5; Region: LIM2_Lhx1_Lhx5; cd09375" /db_xref="CDD:188761" misc_feature 884..1048 /gene="Lhx5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1513 /gene="Lhx5" /note="EBNA-3B; Provisional; Region: PHA03378" /db_xref="...
NM_139036.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H2.0-like homeobox (Hlx), mRNA. (2141 bp)
CDD:238039" misc_feature 1148..1309 /gene="Hlx" /gene_synonym="Hlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 906..1085 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" exon 1086..1270 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" exon 1271..2116 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" ORIGIN // REFERENCE 1 (bases 1 to 2141) AUTHORS Bates MD, Dunagan DT, Welch LC, Kaul A and Harvey RP. TITLE The Hlx homeobox transcription factor is required early in enteric nervous system development...
Synonym: Hlx1
NM_001077674.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H6 family homeobox 1 (Hmx1), mRNA. (1504 bp)
codon_start=1 /product="homeobox protein HMX1" /protein_id="NP_001101833.1" /db_xref="GeneID:360960" /db_xref="RGD:1304928" /translation="MGRAESAWPRCPGPGAVPREVTTQGPAAGGEEAAELAEAPAVGEARGGRRKKTRTVFSRSQVFQLESTFDLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELEAASLSPPGAQRLVRVPVLYHESPPAATGPTLPFPLAPPAPAPPPPLLGFSGALAYPLAAFPAAASVPFLRAQMPGLV" misc_feature order(580..594,598..600,649..651,667..669,706..708, 712..717,724..729,733..741,745..750) /gene="Hmx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 586..747 /gene="Hmx1" /note="Homeobox domain; Region: Homeobox;...
NM_001108363.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. (1845 bp)
LOCUS NM_205252 1845 bp mRNA linear VRT 06-DEC-2020 DEFINITION Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. ACCESSION NM_205252 VERSION NM_205252.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..686 /gene="HHEX" /gene_synonym="PROBOX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 469..647 /gene="HHEX" /gene_synonym="PROBOX" /inference="alignment:Splign:2.1.0" exon...
Synonym: PROBOX
NM_205252.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus brain specific homeobox (Bsx), mRNA. (869 bp)
misc_feature 385..543 /gene="Bsx" /gene_synonym="RGD1565120" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 308..504 /gene="Bsx" /gene_synonym="RGD1565120" /inference="alignment:Splign:2.1.0" exon 505..869 /gene="Bsx" /gene_synonym="RGD1565120" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 869) AUTHORS Carstensen MB, Hertz H, Bering T, Moller M, Rohde K, Klein DC, Coon SL and Rath MF. TITLE Circadian regulation and molecular role of the Bsx homeobox gene in the adult pineal gland JOURNAL J Pineal Res 68 (2), e12629 (2020) PUBMED...
Synonym: RGD1565120
NM_001191995.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 341..523 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order(341..343,350..352,485..487,494..499,506..508) /gene="HB-3" /locus_tag="AT2G33880" /gene...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Homo sapiens leucine twenty homeobox (LEUTX), transcript variant 2, mRNA. (969 bp)
homeobox-like pseudogene; PRD-LIKE homeobox transcription factor LEUTX; paired-like homeobox transcription factor LEUTX; paired-like homeodomain transcription factor LEUTX" /codon_start=1 /product="paired-like homeodomain transcription factor LEUTX isoform 2" /protein_id="NP_001137304.1" /db_xref="GeneID:342900" /db_xref="HGNC:HGNC:31953" /db_xref="MIM:618701" /translation="MHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYDLPGEDDTSSLNQYLFPVCLEYDQLQSSV" misc_feature <307..408 /gene="LEUTX" /note="Homeobox...
NM_001143832.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3), mRNA. (908 bp)
LOCUS NM_001135607 908 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3), mRNA. ACCESSION NM_001135607 VERSION NM_001135607.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...Rhox3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 685..843 /gene="Rhox3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001135607.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus distal-less homeobox 4 (Dlx4), mRNA. (1629 bp)
duct="homeobox protein DLX-4" /protein_id="NP_001100510.1" /db_xref="GeneID:303469" /db_xref="RGD:1308744" /translation="MTSLPCPLPGLGPSNVVFPDLAPASSVVAAYQLGLSPGTAASPDLSFSQTYGHLLSYSYPGPATPGDSYLSSQQQSAAPSRPFHQPTEHPQELEAESEKLALSLEPSQPSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGELEEDFSGRPPSLSPHSLTLPSIWDLPKAGTLPTSGYDNSFGTWYQHHSPDVLALPQRM" misc_feature order(346..360,364..366,415..417,433..435,472..474, 478..483,490..495,499..507,511..516) /gene="Dlx4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 352..513 /gene="Dlx4" /note="Homeobox...
NM_001107040.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. (1036 bp)
LOCUS NM_001129916 1036 bp mRNA linear VRT 05-JAN-2021 DEFINITION Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. ACCESSION NM_001129916 VERSION NM_001129916.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 427..588 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" exon 296..546 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /inference="alignment:...
Synonym: vex1; Xvex-1
NM_001129916.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. (1144 bp)
LOCUS NM_010420 1144 bp mRNA linear ROD 13-FEB-2021 DEFINITION Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. ACCESSION NM_010420 VERSION NM_010420.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 689..853 /gene="Hesx1" /gene_synonym="HES-; HES-1; R; Rpx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order(689..691,698..700,818..820,827..832,839..841) /gene="Hesx1" /gene_synonym...
Synonym: HES-; HES-1; R; Rpx
NM_010420.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus mesenchyme homeobox 2 (Meox2), mRNA. (2247 bp)
arrest-specific homeobox; mesenchyme homeo box 2 (growth arrest-specific homeo box)" /codon_start=1 /product="homeobox protein MOX-2" /protein_id="NP_058845.2" /db_xref="GeneID:29279" /db_xref="RGD:3079" /translation="MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQQQQHQALQSNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEVEKRSGSKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSLANDDSRDSDHSSEHAHL" misc_feature 760..921 /gene="Meox2" /note="Homeobox domain; Region: Homeobox...
NM_017149.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ladybird homeobox 2 (Lbx2), mRNA. (816 bp)
LOCUS NM_001109244 816 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus ladybird homeobox 2 (Lbx2), mRNA. ACCESSION NM_001109244 XM_001072452 XM_575575 VERSION NM_001109244.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 316..477 /gene="Lbx2" /gene_synonym="RGD1561172" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(316..318,325..327,445..447,454..459,466..468) /gene="Lbx2" /gene_synonym="...
Synonym: RGD1561172
NM_001109244.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus reproductive homeobox 9 (Rhox9), mRNA. (898 bp)
LOCUS NM_023894 898 bp mRNA linear ROD 11-JAN-2021 DEFINITION Mus musculus reproductive homeobox 9 (Rhox9), mRNA. ACCESSION NM_023894 VERSION NM_023894.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 551..712 /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpb; Gpbox; Ps; Psx2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(551..553,560..562,680..682,689..694,701..703) /gene="Rhox9" /gene_...
Synonym: 1600026O01Rik; Gpb; Gpbox; Ps; Psx2
NM_023894.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Meis homeobox 3 (Meis3), mRNA. (1794 bp)
product="homeobox protein Meis3" /protein_id="NP_001101942.1" /db_xref="GeneID:361514" /db_xref="RGD:1308532" /translation="MARRYEEPRHYPGITEHTAALASFPEAAPSVPRAPGPYGPHRPPQPQGPGLDSDSLKREKDDIYGHPLFPLLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQIRSERPLFSSNPELDNLMVQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDLEDYAASCPSLPDQNTTWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGYTETQPHVTVRTPGSMGMNLNLEGEWHYL" misc_feature 490..741 /gene="Meis3" /gene_synonym="Mrg2" /note="N-terminal of Homeobox Meis and...
Synonym: Mrg2
NM_001108472.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus SIX homeobox 6 (SIX6), mRNA. (2089 bp)
LOCUS NM_001389365 2089 bp mRNA linear VRT 23-FEB-2021 DEFINITION Gallus gallus SIX homeobox 6 (SIX6), mRNA. ACCESSION NM_001389365 NM_204994 XM_015287285 VERSION NM_001389365.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was...
Synonym: OPTX2; Six9
NM_001389365.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus VENT homeobox (VENTX), mRNA. (1650 bp)
LOCUS NM_001391909 1650 bp mRNA linear VRT 15-JAN-2021 DEFINITION Gallus gallus VENT homeobox (VENTX), mRNA. ACCESSION NM_001391909 XM_015288825 VERSION NM_001391909.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from...
NM_001391909.1 - Gallus gallus (chicken) - NCBI - UCSC

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/homeobox
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.419 | 0.419 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.562 | 0.143 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.568 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]