GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-05-24 11:24:46, GGRNA : RefSeq release 87 (Mar, 2018)



Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Zea mays Zmhox1a homeobox protein (hox1a), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 02-OCT-2017 DEFINITION Zea mays Zmhox1a homeobox protein (hox1a), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript exon...
Synonym: GRMZM2G136369; homeobox1; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 08-OCT-2016 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AABR07030395.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
sequence (NC_003071). FEATURES Location/Qualifiers source 1..1963 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene 1..1963 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Encodes a protein with similarity to WUS type homeodomain protein. Required for meristem growth and development and acts through positive regulation of WUS. Loss of function phenotypes include embryo lethality, hyponastic cotyledons, reduced...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 53 (HB53), mRNA. (941 bp)
NA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox,...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9
NM_126068.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 3 (HB-3), mRNA. (1564 bp)
; HOMEOBOX PROTEIN" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 875..991 /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="Homeobox...
NM_121519.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 05-FEB-2018 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (876 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22" /inference="Similar to RNA sequence, EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1" /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1" /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22
NM_179935.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Arabidopsis thaliana homeobox-leucine zipper protein 4 (HB4), mRNA. (1394 bp)
gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 702..854 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 858..989 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8
NM_130055.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (1018 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /inference="Similar to RNA sequence, EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1, INSD:DR751539.1" /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1" /note="homeobox-leucine zipper protein 17 (HB17); FUNCTIONS IN: sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_126204.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 21 (HB21), mRNA. (1058 bp)
INSD:DR750746.1,INSD:DR750857.1,INSD:DR750745.1" /inference="similar to RNA sequence, mRNA:INSD:BT031362.1,INSD:BT031368.1" /note="homeobox protein 21 (HB21); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Helix-turn-helix motif, lambda...
Synonym: ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2
NM_127411.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (2359 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..2359 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene <1..2359 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /db_xref="Araport:AT2G01430" /db_xref="GeneID:814671" /db_xref="TAIR:AT2G01430" CDS 1..642 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_001335062.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 10 (WOX10), partial mRNA. (594 bp)
db_xref="TAIR:AT1G20710" CDS 1..594 /gene="WOX10" /locus_tag="AT1G20710" /gene_synonym="F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B" /note="WUSCHEL related homeobox 10 (WOX10); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is:...
Synonym: F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B
NM_101923.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1308 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(270..272,279..281,399..401,408..413,420..422) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 279..431 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
NM_001036473.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (826 bp)
xref="GeneID:838660" /db_xref="TAIR:AT1G20700" CDS 1..636 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /inference="Similar to RNA sequence, EST:INSD:DR751559.1,INSD:AA585837.1,INSD:T22843.1, INSD:DR751560.1" /inference="similar to RNA sequence, mRNA:INSD:AJ441297.1" /note="WUSCHEL related homeobox 14 (WOX14); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: WUSCHEL...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_101922.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 5 (WOX5), mRNA. (1052 bp)
WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /note="Arabidopsis thaliana WOX5 protein mRNA" /db_xref="Araport:AT3G11260" /db_xref="GeneID:820297" /db_xref="TAIR:AT3G11260" CDS 327..875 /gene="WOX5" /locus_tag="AT3G11260" /gene_synonym="WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /inference="Similar to RNA sequence, EST:INSD:DR750862.1,INSD:DR751206.1,INSD:DR750861.1, INSD:EH977836.1" /inference="Similar to RNA sequence, mRNA:INSD:AY150812.1,INSD:AY251398.1" /note="WUSCHEL related homeobox 5 (WOX5); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356),...
Synonym: WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B
NM_111961.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 7 (WOX7), partial mRNA. (429 bp)
TAIR:AT5G05770" CDS 61..429 /gene="WOX7" /locus_tag="AT5G05770" /gene_synonym="MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related homeobox 5A; WUSCHEL related homeobox 7" /inference="Similar to RNA sequence, EST:INSD:DR750916.1,INSD:DR751352.1,INSD:DR750917.1" /note="WUSCHEL related homeobox 7 (WOX7); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: WUSCHEL related...
Synonym: MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related homeobox 5A; WUSCHEL related homeobox 7
NM_120659.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 3 (HAT3), mRNA. (1447 bp)
locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(775..777,784..786,904..906,913..918,925..927) /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 784..936 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3
NM_115903.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1474 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(288..290,297..299,417..419,426..431,438..440) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 297..449 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
NM_130233.5 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Zea mays homeobox 3 (hox3), mRNA. (5334 bp)
LOCUS NM_001309211 5334 bp mRNA linear PLN 07-SEP-2017 DEFINITION Zea mays homeobox 3 (hox3), mRNA. ACCESSION NM_001309211 XM_008675214 VERSION NM_001309211.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from LPUQ01001404.1. On May 21, 2015 this sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a
NM_001309211.1 - Zea mays - NCBI
Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. (1821 bp)
LOCUS NM_001165009 1821 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. ACCESSION NM_001165009 VERSION NM_001165009.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="drgx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..692 /gene="drgx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001165009.1 - Saccoglossus kowalevskii - NCBI
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), mRNA. (1365 bp)
. FEATURES Location/Qualifiers source 1..1365 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="1" /ecotype="Columbia" gene 1..1365 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="Encodes WOX14, a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. Functions in the shoot meristem organizing center to...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_001332460.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 12 (HB-12), mRNA. (1054 bp)
." /codon_start=1 /product="homeobox 12" /protein_id="NP_191748.1" /db_xref="GeneID:825362" /db_xref="TAIR:AT3G61890" /db_xref="Araport:AT3G61890" /translation="MEEGDFFNCCFSEISSGMTMNKKKMKKSNNQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQRLNEEMQRPKEEKHHECCGDQGLALSSSTESHNGKSEPEGRLDQGSVLCNDGDYNNNIKTEYFGFEEETDHELMNIVEKADDSCLTSSENWGGFNSDSLLDQSSSNYPNWWEFWS" misc_feature 251..403 /gene="HB-12" /locus_tag="AT3G61890" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
NM_116054.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (866 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..866 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="1" /ecotype="Columbia" gene <1..866 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="Encodes WOX14, a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. Functions in the shoot meristem organizing center to...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_001332461.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL Development 127 (23), 5033-5045 (2000) PUBMED...
Synonym: GH6
NM_205533.2 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana WUSCHEL related homeobox 8 (WOX8), mRNA. (1151 bp)
db_xref="TAIR:AT5G45980" CDS 36..1013 /gene="WOX8" /locus_tag="AT5G45980" /gene_synonym="MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B" /inference="Similar to RNA sequence, EST:INSD:DR750890.1,INSD:AV557790.1,INSD:DR750889.1, INSD:AV556647.1" /inference="similar to RNA sequence, mRNA:INSD:AY251400.1" /note="WUSCHEL related homeobox 8 (WOX8); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: homeobox-3 (TAIR:AT2G33880.1); Has 568 Blast hits to 538...
Synonym: MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B
NM_123966.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (886 bp)
t="homeobox protein MIXL1" /protein_id="NP_990321.1" /db_xref="CGNC:66215" /db_xref="GeneID:395838" /translation="MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLASLPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL" misc_feature order(176..190,194..196,245..247,263..265,302..304, 308..313,320..325,329..337,341..346) /gene="MIXL1" /gene_synonym="CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 182..343 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox...
Synonym: CMIX
NM_204990.1 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X2, mRNA. (5376 bp)
LOCUS XM_008675213 5376 bp mRNA linear PLN 18-DEC-2017 DEFINITION PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X2, mRNA. ACCESSION XM_008675213 VERSION XM_008675213.3 DBLINK BioProject: PRJNA249074 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a
XM_008675213.3 - Zea mays - NCBI
PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X1, mRNA. (5456 bp)
LOCUS XM_008675212 5456 bp mRNA linear PLN 18-DEC-2017 DEFINITION PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X1, mRNA. ACCESSION XM_008675212 VERSION XM_008675212.3 DBLINK BioProject: PRJNA249074 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a
XM_008675212.3 - Zea mays - NCBI
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
MSX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic analysis in dogs of different breeds JOURNAL Anim. Genet...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 8..75 /gene="HOXA6" /standard_name="Hoxa6" /db_xref="UniSTS:536644" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Gallus gallus H6 family homeobox 3 (HMX3), mRNA. (927 bp)
LOCUS NM_001007985 927 bp mRNA linear VRT 01-OCT-2017 DEFINITION Gallus gallus H6 family homeobox 3 (HMX3), mRNA. ACCESSION NM_001007985 XM_426755 VERSION NM_001007985.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NKX5-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 550..711 /gene="HMX3" /gene_synonym="NKX5-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(550..552,559..561,679..681,688..693,700..702) /gene="HMX3" /gene_synonym...
Synonym: NKX5-1
NM_001007985.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus msh homeobox 1 (MSX1), mRNA. (1312 bp)
LOCUS NM_205488 1312 bp mRNA linear VRT 05-FEB-2018 DEFINITION Gallus gallus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_205488 XM_444660 VERSION NM_205488.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 569..730 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(569..571,578..580,698..700,707..712,719..721) /gene="MSX1" /gene_synonym...
Synonym: CHOX-7; GHOX-7; HOX-7
NM_205488.2 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X3, mRNA. (5441 bp)
LOCUS XM_008675215 5441 bp mRNA linear PLN 18-DEC-2017 DEFINITION PREDICTED: Zea mays homeobox 3 (hox3), transcript variant X3, mRNA. ACCESSION XM_008675215 VERSION XM_008675215.3 DBLINK BioProject: PRJNA249074 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a
XM_008675215.3 - Zea mays - NCBI
Pan troglodytes HESX homeobox 1 (HESX1), mRNA. (558 bp)
codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_001075039.1" /db_xref="GeneID:747229" /db_xref="VGNC:VGNC:1836" /translation="MSPSLQEGAQLGESKPSTCSFSIERILGLDQNKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERALKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE" misc_feature order(325..339,343..345,394..396,412..414,451..453, 457..462,469..474,478..486,490..495) /gene="HESX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 331..492 /gene="HESX1" /note="Homeobox domain; Region: Homeobox...
NM_001081570.1 - Pan troglodytes (chimpanzee) - NCBI
Gallus gallus homeobox B5 (HOXB5), mRNA. (1453 bp)
synonym="Ghox-2.1; Hoxb-5" /note="Region: homeobox" misc_feature order(628..642,646..648,697..699,715..717,754..756, 760..765,772..777,781..789,793..798) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(634..636,643..645,763..765,772..777,784..786) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 637..795 /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Ghox-2.1; Hoxb-5
NM_001025355.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox A5 (HOXA5), mRNA. (1191 bp)
Synonym: HOX1.3; HOX1C
NM_001318419.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 01-OCT-2017 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox D8 (HOXD8), mRNA. (1263 bp)
order(457..459,466..468,586..588,595..600,607..609) /gene="HOXD8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 460..618 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1263) AUTHORS Crompton MR, MacGregor AD and Goodwin GH. TITLE cDNA cloning of a homeobox-containing gene expressed in avian myeloblastic virus-transformed chicken monoblastic leukaemia cells JOURNAL Leukemia 5 (5), 357-360 (1991) PUBMED 1674560...
NM_207177.1 - Gallus gallus (chicken) - NCBI - UCSC
Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. (2158 bp)
LOCUS NM_001164939 2158 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. ACCESSION NM_001164939 VERSION NM_001164939.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 487..645 /gene="hox6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2158) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164939.1 - Saccoglossus kowalevskii - NCBI
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Oryzias latipes GS homeobox 2 (gsx2), mRNA. (1195 bp)
LOCUS NM_001122909 1195 bp mRNA linear VRT 16-FEB-2018 DEFINITION Oryzias latipes GS homeobox 2 (gsx2), mRNA. ACCESSION NM_001122909 VERSION NM_001122909.1 KEYWORDS RefSeq. SOURCE Oryzias latipes (Japanese medaka) ORGANISM Oryzias latipes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="gsx2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 480..638 /gene="gsx2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001122909.1 - Oryzias latipes (Japanese medaka) - NCBI
Arabidopsis thaliana homeobox protein 25 (HB25), mRNA. (1553 bp)
chromosome="5" /ecotype="Columbia" gene 1..1553 /gene="HB25" /locus_tag="AT5G65410" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 25; ATHB25; homeobox protein 25; MNA5.14; MNA5_14; ZFHD2; ZHD1; ZINC FINGER HOMEODOMAIN 1; ZINC FINGER HOMEODOMAIN 2" /note="Encodes ZFHD2, a member of the zinc...IN: intracellular; EXPRESSED IN: 14 plant structures; EXPRESSED DURING: 9 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox domain, ZF-HD class (InterPro:IPR006455), ZF-HD homeobox protein, Cys/His-rich dimerisation domain (InterPro:IPR006456), Zinc finger, C2H2-type (InterPro:IPR007087),...
NM_125939.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus msh homeobox 2 (MSX2), mRNA. (1107 bp)
LOCUS NM_204559 1107 bp mRNA linear VRT 01-OCT-2017 DEFINITION Gallus gallus msh homeobox 2 (MSX2), mRNA. ACCESSION NM_204559 VERSION NM_204559.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 510..671 /gene="MSX2" /gene_synonym="HOX-8; Msx-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(510..512,519..521,639..641,648..653,660..662) /gene="MSX2" /gene_synonym="...
Synonym: HOX-8; Msx-2
NM_204559.1 - Gallus gallus (chicken) - NCBI - UCSC
Oryctolagus cuniculus paired related homeobox 1 (PRRX1), mRNA. (738 bp)
PRRX1" /note="paired related homeobox 1" /db_xref="GeneID:100354194" CDS 1..738 /gene="PRRX1" /note="paired mesoderm homeobox 1" /codon_start=1 /product="paired mesoderm homeobox protein 1" /protein_id="NP_001306509.1" /db_xref="GeneID:100354194" /translation="MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN" misc_feature 295..450 /gene="PRRX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db...
NM_001319580.1 - Oryctolagus cuniculus (rabbit) - NCBI
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
mol_type="mRNA" /strain="mixed" /db_xref="taxon:10116" /chromosome="4" /map="4q24" gene 1..1518 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. (555 bp)
LOCUS NM_001081487 555 bp mRNA linear PRI 02-OCT-2017 DEFINITION Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. ACCESSION NM_001081487 XM_001136381 XM_524055 VERSION NM_001081487.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 91..249 /gene="RAX2" /gene_synonym="RAXL1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" ORIGIN //...
Synonym: RAXL1
NM_001081487.1 - Pan troglodytes (chimpanzee) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.139 | 0.139 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.233 | 0.094 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.240 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]