GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2020-09-20 16:24:55, GGRNA : RefSeq release 201 (Jul, 2020)



Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 20-JUN-2020 DEFINITION Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript...
Synonym: GRMZM2G136369; homeobox1; hox1a; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Zea mays homeobox 3 (LOC542440), mRNA. (5334 bp)
LOCUS NM_001309211 5334 bp mRNA linear PLN 30-JUN-2020 DEFINITION Zea mays homeobox 3 (LOC542440), mRNA. ACCESSION NM_001309211 XM_008675214 VERSION NM_001309211.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from LPUQ01001404.1. On May 21, 2015 this sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a; hox3
NM_001309211.1 - Zea mays - NCBI
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 20-JUN-2020 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Zea mays HOX1B protein (LOC732843), mRNA. (2974 bp)
c 1346-2098 EB403344.1 1-753 2099-2974 LPUQ01002925.1 503323-504198 c FEATURES Location/Qualifiers source 1..2974 /organism="Zea mays" /mol_type="mRNA" /cultivar="B73" /db_xref="taxon:4577" /chromosome="6" /map="6" gene 1..2974 /gene="LOC732843" /gene_synonym="GRMZM2G094935; homeobox2; Hox1b" /note="HOX1B protein" /db_xref="GeneID:732843" exon 1..127 /gene="LOC732843" /gene_synonym="GRMZM2G094935; homeobox2; Hox1b" /inference="alignment:Splign:2.1.0" exon 128..714 /gene="LOC732843" /gene_synonym="GRMZM2G094935; homeobox2; Hox1b" /inference="alignment:Splign:2.1.0" misc_feature 242..244 /gene="...
Synonym: GRMZM2G094935; homeobox2; Hox1b
NM_001112448.2 - Zea mays - NCBI
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
PREDICTED: Zea mays homeobox 3 (LOC542440), transcript variant X2, mRNA. (5376 bp)
LOCUS XM_008675213 5376 bp mRNA linear PLN 12-MAY-2020 DEFINITION PREDICTED: Zea mays homeobox 3 (LOC542440), transcript variant X2, mRNA. ACCESSION XM_008675213 VERSION XM_008675213.3 DBLINK BioProject: PRJNA249074 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a; hox3
XM_008675213.3 - Zea mays - NCBI
PREDICTED: Zea mays homeobox 3 (LOC542440), transcript variant X1, mRNA. (5456 bp)
LOCUS XM_008675212 5456 bp mRNA linear PLN 12-MAY-2020 DEFINITION PREDICTED: Zea mays homeobox 3 (LOC542440), transcript variant X1, mRNA. ACCESSION XM_008675212 VERSION XM_008675212.3 DBLINK BioProject: PRJNA249074 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a; hox3
XM_008675212.3 - Zea mays - NCBI
PREDICTED: Zea mays homeobox 3 (LOC542440), transcript variant X3, mRNA. (5441 bp)
LOCUS XM_008675215 5441 bp mRNA linear PLN 12-MAY-2020 DEFINITION PREDICTED: Zea mays homeobox 3 (LOC542440), transcript variant X3, mRNA. ACCESSION XM_008675215 VERSION XM_008675215.3 DBLINK BioProject: PRJNA249074 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a; hox3
XM_008675215.3 - Zea mays - NCBI
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 328..1018 /gene="HMX1" /gene_synonym="GH6" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL...
Synonym: GH6
NM_205533.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (886 bp)
t="homeobox protein MIXL1" /protein_id="NP_990321.1" /db_xref="CGNC:66215" /db_xref="GeneID:395838" /translation="MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLASLPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL" misc_feature order(176..190,194..196,245..247,263..265,302..304, 308..313,320..325,329..337,341..346) /gene="MIXL1" /gene_synonym="CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 182..343 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox...
Synonym: CMIX
NM_204990.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus H6 family homeobox 3 (HMX3), mRNA. (927 bp)
LOCUS NM_001007985 927 bp mRNA linear VRT 25-JUN-2020 DEFINITION Gallus gallus H6 family homeobox 3 (HMX3), mRNA. ACCESSION NM_001007985 XM_426755 VERSION NM_001007985.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NKX5-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 550..711 /gene="HMX3" /gene_synonym="NKX5-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(550..552,559..561,679..681,688..693,700..702) /gene="HMX3" /gene_synonym...
Synonym: NKX5-1
NM_001007985.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox A5 (HOXA5), mRNA. (1191 bp)
Synonym: HOX1.3; HOX1C
NM_001318419.1 - Gallus gallus (chicken) - NCBI - UCSC
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..379 /gene="MSX2" /inference="alignment:Splign:2.1.0" exon 380..804 /gene="MSX2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Gallus gallus homeobox D8 (HOXD8), mRNA. (1263 bp)
order(457..459,466..468,586..588,595..600,607..609) /gene="HOXD8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 460..618 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1263) AUTHORS Crompton MR, MacGregor AD and Goodwin GH. TITLE cDNA cloning of a homeobox-containing gene expressed in avian myeloblastic virus-transformed chicken monoblastic leukaemia cells JOURNAL Leukemia 5 (5), 357-360 (1991) PUBMED 1674560...
NM_207177.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus msh homeobox 2 (MSX2), mRNA. (1107 bp)
LOCUS NM_204559 1107 bp mRNA linear VRT 20-JUN-2020 DEFINITION Gallus gallus msh homeobox 2 (MSX2), mRNA. ACCESSION NM_204559 VERSION NM_204559.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 510..671 /gene="MSX2" /gene_synonym="HOX-8; Msx-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(510..512,519..521,639..641,648..653,660..662) /gene="MSX2" /gene_synonym="...
Synonym: HOX-8; Msx-2
NM_204559.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox B5 (HOXB5), mRNA. (1453 bp)
synonym="Ghox-2.1; Hoxb-5" /note="Region: homeobox" misc_feature order(628..642,646..648,697..699,715..717,754..756, 760..765,772..777,781..789,793..798) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(634..636,643..645,763..765,772..777,784..786) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 637..795 /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Ghox-2.1; Hoxb-5
NM_001025355.1 - Gallus gallus (chicken) - NCBI - UCSC
Homo sapiens leucine twenty homeobox (LEUTX), transcript variant 2, mRNA. (969 bp)
homeobox-like pseudogene; PRD-LIKE homeobox transcription factor LEUTX; paired-like homeobox transcription factor LEUTX; paired-like homeodomain transcription factor LEUTX" /codon_start=1 /product="paired-like homeodomain transcription factor LEUTX isoform 2" /protein_id="NP_001137304.1" /db_xref="GeneID:342900" /db_xref="HGNC:HGNC:31953" /db_xref="MIM:618701" /translation="MHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYDLPGEDDTSSLNQYLFPVCLEYDQLQSSV" misc_feature <307..408 /gene="LEUTX" /note="Homeobox...
NM_001143832.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Xenopus tropicalis pituitary homeobox 3-like [provisional] (homeobox100496651-provisional), mRNA. (1234 bp)
LOCUS XM_002941764 1234 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis pituitary homeobox 3-like [provisional] (homeobox100496651-provisional), mRNA. ACCESSION XM_002941764 VERSION XM_002941764.5 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_002941764.5 - Xenopus tropicalis (tropical clawed frog) - NCBI
Gallus gallus homeobox D12 (HOXD12), mRNA. (1419 bp)
LOCUS NM_205249 1419 bp mRNA linear VRT 26-JUN-2020 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 676..837 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(676..678,685..687,805..807,814..819,826..828) /gene="HOXD12" /note="specific DNA base...
NM_205249.1 - Gallus gallus (chicken) - NCBI - UCSC
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Bos taurus retina and anterior neural fold homeobox 2 (RAX2), mRNA. (1828 bp)
gene="RAX2" /gene_synonym="QRX" /note="Region: homeobox domain" misc_feature order(130..144,148..150,199..201,217..219,256..258, 262..267,274..279,283..291,295..300) /gene="RAX2" /gene_synonym="QRX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(136..138,145..147,265..267,274..279,286..288) /gene="RAX2" /gene_synonym="QRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 139..297 /gene="RAX2" /gene_synonym="QRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
Synonym: QRX
NM_182653.1 - Bos taurus (cattle) - NCBI
Gallus gallus msh homeobox 1 (MSX1), mRNA. (1312 bp)
LOCUS NM_205488 1312 bp mRNA linear VRT 23-JUN-2020 DEFINITION Gallus gallus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_205488 XM_444660 VERSION NM_205488.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 569..730 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(569..571,578..580,698..700,707..712,719..721) /gene="MSX1" /gene_synonym...
Synonym: CHOX-7; GHOX-7; HOX-7
NM_205488.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D13 (HOXD13), mRNA. (1964 bp)
LOCUS NM_205434 1964 bp mRNA linear VRT 27-JUN-2020 DEFINITION Gallus gallus homeobox D13 (HOXD13), mRNA. ACCESSION NM_205434 XM_429309 VERSION NM_205434.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 719..880 /gene="HOXD13" /gene_synonym="chox-4.8; chox-4G" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(719..721,728..730,848..850,857..862,869..871) /gene="HOXD13" /gene_...
Synonym: chox-4.8; chox-4G
NM_205434.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus reproductive homeobox 9 (Rhox9), mRNA. (829 bp)
reproductive homeobox 9" /protein_id="NP_001020045.1" /db_xref="GeneID:298352" /db_xref="RGD:1563844" /translation="MDTPQDSCQSFQKSLSLGAEVDPEQQHGGTAVVSEAREVGDQSQRLVGGLVQGGLDQGQPTQGQLAGGNLPQEEPAELSLAQEATGVEEEGDEKEEEMEARYAGDGAYGPEDNNVQQEGDQHPNDQEQPQQEAAIPEGNRGQQAGNRLVHPRHTRPRFTHSQLRDLERLFQETRYPSLRTRKDLARWMGVPESDVQDWFRMRRSLFRRNSRLLMFCELPPIPENNPS" misc_feature order(462..476,480..482,531..533,549..551,588..590, 594..599,606..611,615..623,627..632) /gene="Rhox9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 468..629 /gene="Rhox9" /note="Homeobox domain; Region:...
NM_001024874.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 08-OCT-2016 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AABR07030395.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Papio anubis homeobox A1 (HOXA1), mRNA. (1008 bp)
NM_001169063.1 - Papio anubis (olive baboon) - NCBI
Strongylocentrotus purpuratus homeobox (H-6 family) (HMX), mRNA. (1402 bp)
misc_feature order(881..895,899..901,950..952,968..970,1007..1009, 1013..1018,1025..1030,1034..1042,1046..1051) /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 887..1048 /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(887..889,896..898,1016..1018,1025..1030,1037..1039) /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1...
Synonym: homeobox; SpHmx
NM_214561.2 - Strongylocentrotus purpuratus (purple sea urchin) - NCBI
Pan troglodytes HESX homeobox 1 (HESX1), mRNA. (558 bp)
codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_001075039.1" /db_xref="GeneID:747229" /db_xref="VGNC:VGNC:1836" /translation="MSPSLQEGAQLGESKPSTCSFSIERILGLDQNKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERALKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE" misc_feature order(325..339,343..345,394..396,412..414,451..453, 457..462,469..474,478..486,490..495) /gene="HESX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 331..492 /gene="HESX1" /note="Homeobox domain; Region: Homeobox...
NM_001081570.1 - Pan troglodytes (chimpanzee) - NCBI
Fundulus heteroclitus homeobox A2b (hoxa2b), mRNA. (1318 bp)
SAMN03775336 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1318 /organism="Fundulus heteroclitus" /mol_type="mRNA" /db_xref="taxon:8078" gene 1..1318 /gene="hoxa2b" /gene_synonym="Hoxa2x" /note="homeobox A2b" /db_xref="GeneID:105926292" CDS 121..1110 /gene="hoxa2b" /gene_synonym="Hoxa2x" /note="homeobox A2x; Hox A2b; Homeobox protein Hox-A2" /codon_start=1 /product="homeobox protein Hox-A2b" /protein_id="NP_001296907.1" /db_xref="GeneID:105926292" /translation="...
Synonym: Hoxa2x
NM_001309978.1 - Fundulus heteroclitus (mummichog) - NCBI
Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. (894 bp)
LOCUS NM_205015 894 bp mRNA linear VRT 26-JUN-2020 DEFINITION Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. ACCESSION NM_205015 XM_429269 VERSION NM_205015.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...TLX-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 511..672 /gene="TLX1" /gene_synonym="TLX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(511..513,520..522,640..642,649..654,661..663) /gene="TLX1" /gene_synonym="...
Synonym: TLX-1
NM_205015.1 - Gallus gallus (chicken) - NCBI - UCSC
Ovis aries homeobox C6 (HOXC6), mRNA. (1196 bp)
LOCUS NM_001009335 1196 bp mRNA linear MAM 25-JUN-2020 DEFINITION Ovis aries homeobox C6 (HOXC6), mRNA. ACCESSION NM_001009335 VERSION NM_001009335.1 KEYWORDS RefSeq. SOURCE Ovis aries (sheep) ORGANISM Ovis aries Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria;...HOXC6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 199..360 /gene="HOXC6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:333795" ORIGIN //...
NM_001009335.1 - Ovis aries (sheep) - NCBI
Pongo abelii PBX/knotted 1 homeobox 2 (PKNOX2), mRNA. (3427 bp)
LOCUS NM_001134095 3427 bp mRNA linear PRI 27-JUN-2020 DEFINITION Pongo abelii PBX/knotted 1 homeobox 2 (PKNOX2), mRNA. ACCESSION NM_001134095 VERSION NM_001134095.1 KEYWORDS RefSeq. SOURCE Pongo abelii (Sumatran orangutan) ORGANISM Pongo abelii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...misc_feature 506..757 /gene="PKNOX2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:293102" misc_feature order(1085..1099,1103..1105,1163..1165,1181..1183, 1220..1222,1226..1231,1238..1243,1247..1255) /gene="PKNOX2" /note="DNA binding site...
NM_001134095.1 - Pongo abelii (Sumatran orangutan) - NCBI
Oncorhynchus mykiss caudal-type homeobox protein 1 (cdx1), mRNA. (1497 bp)
cdx1" /inference="non-experimental evidence, no additional details recorded" /note="Region: homeobox" misc_feature order(545..556,560..562,611..613,629..631,668..670, 674..679,686..691,695..703,707..712) /gene="cdx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(548..550,557..559,677..679,686..691,698..700) /gene="cdx1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 551..709 /gene="cdx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 563..607 /gene="cdx1" /...
NM_001124632.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. (555 bp)
LOCUS NM_001081487 555 bp mRNA linear PRI 20-JUN-2020 DEFINITION Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. ACCESSION NM_001081487 XM_001136381 XM_524055 VERSION NM_001081487.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 91..249 /gene="RAX2" /gene_synonym="RAXL1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" exon 1..216 /gene="RAX2" /gene_synonym="RAXL1" /inference="alignment:Splign:2.1.0" exon...
Synonym: RAXL1
NM_001081487.1 - Pan troglodytes (chimpanzee) - NCBI
Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. (1891 bp)
LOCUS NM_001005427 1891 bp mRNA linear VRT 25-JUN-2020 DEFINITION Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. ACCESSION NM_001005427 XM_418692 VERSION NM_001005427.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...MEOX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 605..763 /gene="MEOX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 552..724 /gene="MEOX2" /inference="alignment:Splign:2.1.0" exon 725..1891 /gene="...
NM_001005427.1 - Gallus gallus (chicken) - NCBI - UCSC
Pongo abelii Meis homeobox 2 (MEIS2), mRNA. (1735 bp)
NM_001133677.1 - Pongo abelii (Sumatran orangutan) - NCBI
Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-3.S), mRNA. (742 bp)
gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(374..376,383..385,503..505,512..517,524..526) /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 742) AUTHORS Newman CS and Krieg PA. TITLE The Xenopus bagpipe-related homeobox gene zampogna is expressed in the pharyngeal endoderm and the visceral musculature of the midgut...
Synonym: bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A
NM_001085685.1 - Xenopus laevis (African clawed frog) - NCBI
Canis lupus familiaris cone-rod homeobox (CRX), mRNA. (3299 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 592..849 /gene="CRX" /note="Otx1 transcription factor; Region: TF_Otx; pfam03529" /db_xref="CDD:281521" exon 203..354 /gene="CRX" /inference="alignment:Splign:2.1.0" exon 355..3289 /gene="CRX" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 3299) AUTHORS Akhmedov NB, Baldwin VJ, Zangerl B, Kijas JW, Hunter L, Minoofar KD, Mellersh C, Ostrander EA, Acland GM, Farber DB and Aguirre GD. TITLE Cloning and characterization of the canine photoreceptor specific cone-rod homeobox (CRX) gene and...
NM_001003049.1 - Canis lupus familiaris (dog) - NCBI
Xenopus tropicalis H6 family homeobox 3 (hmx3), mRNA. (2200 bp)
LOCUS NM_001079361 2200 bp mRNA linear VRT 20-JUN-2020 DEFINITION Xenopus tropicalis H6 family homeobox 3 (hmx3), mRNA. ACCESSION NM_001079361 VERSION NM_001079361.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 763..924 /gene="hmx3" /gene_synonym="nkx-5.1; nkx5-1; nkx5.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(763..765,772..774,892..894,901..906,913..915) /gene="hmx3" /gene_...
Synonym: nkx-5.1; nkx5-1; nkx5.1
NM_001079361.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Salmo salar distal-less homeobox 5a (dlx5a), mRNA. (1115 bp)
synonym="dlx5" /note="distal-less homeobox gene 5a; distal-less homeobox 5" /codon_start=1 /product="homeobox protein Dlx5a" /protein_id="NP_001134142.1" /db_xref="GeneID:100195641" /translation="MTGVFDRRIPSIKPADFQNPFQLSTTMHHPSQESPTLPESTATDSGYYSPAGAVHHGYCSPNSTSYGKPINAYQYQYHGVNGSAGNYPAKTYPDYSAYTASAYHQYAGTYSRVQPQPLSPQEKEVAEPEVRMVNGKPKKIRKPRTIYSSFQLAALQRRFQNTQYLALPERAELAASLGLTQTQVKIWFQNKRSKLKKIMKNGELPPEHSPSSSDPMACNSPHSPAVWDTQGPSRPHSHQAQNNNSAASTFLENSASWYSAAGAMNSHLQAPNSIQHSLVLGSGTLY" misc_feature 188..454 /gene="dlx5a" /gene_synonym="dlx5" /note="Homeobox protein distal-less-like N terminal; Region...
Synonym: dlx5
NM_001140670.1 - Salmo salar (Atlantic salmon) - NCBI
Gallus gallus caudal type homeobox 4 (CDX4), mRNA. (1453 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 524..669 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" exon 670..1445 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1453) AUTHORS Joshi P, Darr AJ and Skromne I. TITLE CDX4 regulates the progression of neural maturation in the spinal cord JOURNAL Dev. Biol. 449 (2), 132-142 (2019) PUBMED 30825428 REMARK GeneRIF: Results show that in the spinal cord, caudal type homeobox 4 (CDX4)...
Synonym: cCdx-B; CDXB; CHOX-CAD2; ox-cad2
NM_204614.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus NK2 homeobox 6 (NKX2-6), mRNA. (1111 bp)
uct="homeobox protein Nkx-2.6" /protein_id="NP_990468.1" /db_xref="CGNC:49622" /db_xref="GeneID:396037" /translation="MLPTPFSVEDILSLEQSSAPGAPGVRRSPSVEEEPPSGQCLLSQPLQADQQQTDPCHHPKQPQRRKPRVLFSQTQVLELERRFKQQKYLSALEREHLANVLQLTSTQVKIWFQNRRYKCKRQRQDRSLEMATYPLPPRKVAVPVLVRNGKPCFEGSQPHLAPYGITVSPYSYSTYYSAYGVSYGVGYTGVLTP" misc_feature order(224..238,242..244,293..295,311..313,350..352, 356..361,368..373,377..385,389..394) /gene="NKX2-6" /gene_synonym="NKX2.8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 230..391 /gene="NKX2-6" /gene_synonym="NKX2.8" /note="Homeobox...
Synonym: NKX2.8
NM_205137.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus sensory organ homeobox (SOHO1), mRNA. (1820 bp)
gene="SOHO1" /gene_synonym="SOHO-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(423..425,432..434,552..554,561..566,573..575) /gene="SOHO1" /gene_synonym="SOHO-1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 250..1805 /gene="SOHO1" /gene_synonym="SOHO-1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1820) AUTHORS Deitcher DL, Fekete DM and Cepko CL. TITLE Asymmetric expression of a novel homeobox gene in vertebrate sensory organs JOURNAL J. Neurosci...
Synonym: SOHO-1
NM_205386.1 - Gallus gallus (chicken) - NCBI - UCSC
Salmo salar PROP paired-like homeobox 1 (prop1), mRNA. (1119 bp)
misc_feature 191..352 /gene="prop1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(191..193,200..202,320..322,329..334,341..343) /gene="prop1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 96..319 /gene="prop1" /inference="alignment:Splign:2.0.8" exon 320..1095 /gene="prop1" /inference="alignment:Splign:2.0.8" ORIGIN // REFERENCE 1 (bases 1 to 1119) AUTHORS Angotzi AR, Mungpakdee S, Stefansson S, Male R and Chourrout D. TITLE Involvement of Prop1 homeobox gene in the early development of fish...
NM_001136547.1 - Salmo salar (Atlantic salmon) - NCBI
Gallus gallus homeobox D11 (HOXD11), mRNA. (1006 bp)
LOCUS NM_204620 1006 bp mRNA linear VRT 20-JUN-2020 DEFINITION Gallus gallus homeobox D11 (HOXD11), mRNA. ACCESSION NM_204620 XM_001234561 VERSION NM_204620.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...GHOX4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 709..870 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(709..711,718..720,838..840,847..852,859..861) /gene="HOXD11" /gene_...
Synonym: GHOX4.6
NM_204620.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox A6 (HOXA6), mRNA. (1467 bp)
LOCUS NM_001030987 1467 bp mRNA linear VRT 02-JUL-2020 DEFINITION Gallus gallus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001030987 XM_418729 VERSION NM_001030987.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 469..627 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..436 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /inference="alignment:...
Synonym: HOX1; HOX1.2; HOX1B
NM_001030987.2 - Gallus gallus (chicken) - NCBI - UCSC
PREDICTED: Zea mays HOX1B protein (LOC732843), transcript variant X1, mRNA. (2893 bp)
Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2893 /organism="Zea mays" /mol_type="mRNA" /cultivar="B73" /db_xref="taxon:4577" /chromosome="6" /tissue_type="seedling" /country="USA" gene 1..2893 /gene="LOC732843" /gene_synonym="GRMZM2G094935; homeobox2; Hox1b" /note="HOX1B protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 ESTs, 14 long SRA reads, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 189 samples with...
Synonym: GRMZM2G094935; homeobox2; Hox1b
XM_020539217.2 - Zea mays - NCBI
Haplochromis burtoni distal-less homeobox 3b (dlx3b), mRNA. (1639 bp)
gene_synonym="dlx3" /note="distal-less homeobox protein 3b; distal-less homeobox 3" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001273244.1" /db_xref="GeneID:102307675" /translation="MSAGQTYEKKIASILTDLPGSMSCHPNSKDSPTLPESSVTDMGYYSGQTAHGHHEYYQSQPYGQPMNSYHHQFNLNGMGAAGAYATKSEYPYTNGYRQYGHYNRDHLQASPPGSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNASDSMACNSPPSPAVWDNSSTPQNTPISRPQVPQPTHSSSPPYLEDYNNHWYQQGSHLQHPGAVHHPVPQQSVGAVY" misc_feature 195..446 /gene="dlx3b" /gene_synonym="dlx3" /note="Homeobox protein distal-less-like N terminal;...
Synonym: dlx3
NM_001286315.1 - Haplochromis burtoni (Burton's mouthbrooder) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.174 | 0.174 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.328 | 0.154 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.334 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]