GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-10-20 19:45:40, GGRNA : RefSeq release 90 (Sep, 2018)



Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Zea mays Zmhox1a homeobox protein (hox1a), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 02-JUN-2018 DEFINITION Zea mays Zmhox1a homeobox protein (hox1a), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript exon...
Synonym: GRMZM2G136369; homeobox1; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 21-JUL-2018 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1;...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (583 bp)
LOCUS NR_131758 583 bp RNA linear ROD 26-MAY-2018 DEFINITION Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_131758 VERSION NR_131758.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT PREDICTED REFSEQ: This record has not been reviewed and the function is unknown. The reference sequence was derived from AK002860.1. ##Evidence-...
Synonym: 0610040B09Rik; AV302770; Hoxb5/6as
NR_131758.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (886 bp)
t="homeobox protein MIXL1" /protein_id="NP_990321.1" /db_xref="CGNC:66215" /db_xref="GeneID:395838" /translation="MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLASLPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL" misc_feature order(176..190,194..196,245..247,263..265,302..304, 308..313,320..325,329..337,341..346) /gene="MIXL1" /gene_synonym="CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 182..343 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox...
Synonym: CMIX
NM_204990.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus H6 family homeobox 3 (HMX3), mRNA. (927 bp)
LOCUS NM_001007985 927 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus H6 family homeobox 3 (HMX3), mRNA. ACCESSION NM_001007985 XM_426755 VERSION NM_001007985.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NKX5-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 550..711 /gene="HMX3" /gene_synonym="NKX5-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(550..552,559..561,679..681,688..693,700..702) /gene="HMX3" /gene_synonym...
Synonym: NKX5-1
NM_001007985.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 328..1018 /gene="HMX1" /gene_synonym="GH6" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL...
Synonym: GH6
NM_205533.2 - Gallus gallus (chicken) - NCBI - UCSC
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..379 /gene="MSX2" /inference="alignment:Splign:2.1.0" exon 380..804 /gene="MSX2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Gallus gallus homeobox A5 (HOXA5), mRNA. (1191 bp)
Synonym: HOX1.3; HOX1C
NM_001318419.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox B5 (HOXB5), mRNA. (1453 bp)
synonym="Ghox-2.1; Hoxb-5" /note="Region: homeobox" misc_feature order(628..642,646..648,697..699,715..717,754..756, 760..765,772..777,781..789,793..798) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(634..636,643..645,763..765,772..777,784..786) /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 637..795 /gene="HOXB5" /gene_synonym="Ghox-2.1; Hoxb-5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: Ghox-2.1; Hoxb-5
NM_001025355.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus msh homeobox 2 (MSX2), mRNA. (1107 bp)
LOCUS NM_204559 1107 bp mRNA linear VRT 23-JUN-2018 DEFINITION Gallus gallus msh homeobox 2 (MSX2), mRNA. ACCESSION NM_204559 VERSION NM_204559.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 510..671 /gene="MSX2" /gene_synonym="HOX-8; Msx-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(510..512,519..521,639..641,648..653,660..662) /gene="MSX2" /gene_synonym="...
Synonym: HOX-8; Msx-2
NM_204559.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D8 (HOXD8), mRNA. (1263 bp)
HOXD8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 460..618 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 289..436 /gene="HOXD8" /inference="alignment:Splign:2.1.0" exon 437..1250 /gene="HOXD8" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1263) AUTHORS Crompton MR, MacGregor AD and Goodwin GH. TITLE cDNA cloning of a homeobox-containing gene expressed in avian myeloblastic virus-transformed chicken monoblastic leukaemia cells JOURNAL Leukemia...
NM_207177.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 27-MAY-2018 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus homeobox D12 (HOXD12), mRNA. (1419 bp)
LOCUS NM_205249 1419 bp mRNA linear VRT 21-JUL-2018 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 676..837 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(676..678,685..687,805..807,814..819,826..828) /gene="HOXD12" /note="specific DNA base...
NM_205249.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
sequence (NC_003071). FEATURES Location/Qualifiers source 1..1963 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene 1..1963 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Encodes a protein with similarity to WUS type homeodomain protein. Required for meristem growth and development and acts through positive regulation of WUS. Loss of function phenotypes include embryo lethality, hyponastic cotyledons, reduced...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus reproductive homeobox 9 (Rhox9), mRNA. (829 bp)
reproductive homeobox 9" /protein_id="NP_001020045.1" /db_xref="GeneID:298352" /db_xref="RGD:1563844" /translation="MDTPQDSCQSFQKSLSLGAEVDPEQQHGGTAVVSEAREVGDQSQRLVGGLVQGGLDQGQPTQGQLAGGNLPQEEPAELSLAQEATGVEEEGDEKEEEMEARYAGDGAYGPEDNNVQQEGDQHPNDQEQPQQEAAIPEGNRGQQAGNRLVHPRHTRPRFTHSQLRDLERLFQETRYPSLRTRKDLARWMGVPESDVQDWFRMRRSLFRRNSRLLMFCELPPIPENNPS" misc_feature order(462..476,480..482,531..533,549..551,588..590, 594..599,606..611,615..623,627..632) /gene="Rhox9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 468..629 /gene="Rhox9" /note="Homeobox domain; Region:...
NM_001024874.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Pan troglodytes HESX homeobox 1 (HESX1), mRNA. (558 bp)
codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_001075039.1" /db_xref="GeneID:747229" /db_xref="VGNC:VGNC:1836" /translation="MSPSLQEGAQLGESKPSTCSFSIERILGLDQNKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERALKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE" misc_feature order(325..339,343..345,394..396,412..414,451..453, 457..462,469..474,478..486,490..495) /gene="HESX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 331..492 /gene="HESX1" /note="Homeobox domain; Region: Homeobox...
NM_001081570.1 - Pan troglodytes (chimpanzee) - NCBI
Rattus norvegicus reproductive homeobox 8 (Rhox8), mRNA. (738 bp)
LOCUS NM_001025776 738 bp mRNA linear ROD 25-JUL-2018 DEFINITION Rattus norvegicus reproductive homeobox 8 (Rhox8), mRNA. ACCESSION NM_001025776 XM_578961 VERSION NM_001025776.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...Rhox8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 361..519 /gene="Rhox8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..64 /gene="Rhox8" /inference="alignment:Splign:2.0.8" exon 65..440 /gene="Rhox8" /...
NM_001025776.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. (1821 bp)
LOCUS NM_001165009 1821 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. ACCESSION NM_001165009 VERSION NM_001165009.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="drgx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..692 /gene="drgx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001165009.1 - Saccoglossus kowalevskii - NCBI
Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. (1891 bp)
LOCUS NM_001005427 1891 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. ACCESSION NM_001005427 XM_418692 VERSION NM_001005427.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...MEOX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 605..763 /gene="MEOX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1891) AUTHORS Reijntjes,S., Stricker,S. and Mankoo,B.S....
NM_001005427.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus T cell leukemia homeobox 1 (TLX1), mRNA. (894 bp)
LOCUS NM_205015 894 bp mRNA linear VRT 18-JUL-2018 DEFINITION Gallus gallus T cell leukemia homeobox 1 (TLX1), mRNA. ACCESSION NM_205015 XM_429269 VERSION NM_205015.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...TLX-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 511..672 /gene="TLX1" /gene_synonym="TLX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(511..513,520..522,640..642,649..654,661..663) /gene="TLX1" /gene_synonym="...
Synonym: TLX-1
NM_205015.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus NK2 homeobox 6 (NKX2-6), mRNA. (1111 bp)
uct="homeobox protein Nkx-2.6" /protein_id="NP_990468.1" /db_xref="CGNC:49622" /db_xref="GeneID:396037" /translation="MLPTPFSVEDILSLEQSSAPGAPGVRRSPSVEEEPPSGQCLLSQPLQADQQQTDPCHHPKQPQRRKPRVLFSQTQVLELERRFKQQKYLSALEREHLANVLQLTSTQVKIWFQNRRYKCKRQRQDRSLEMATYPLPPRKVAVPVLVRNGKPCFEGSQPHLAPYGITVSPYSYSTYYSAYGVSYGVGYTGVLTP" misc_feature order(224..238,242..244,293..295,311..313,350..352, 356..361,368..373,377..385,389..394) /gene="NKX2-6" /gene_synonym="NKX2.8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 230..391 /gene="NKX2-6" /gene_synonym="NKX2.8" /note="Homeobox...
Synonym: NKX2.8
NM_205137.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus msh homeobox 1 (MSX1), mRNA. (1312 bp)
LOCUS NM_205488 1312 bp mRNA linear VRT 26-JUN-2018 DEFINITION Gallus gallus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_205488 XM_444660 VERSION NM_205488.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 569..730 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(569..571,578..580,698..700,707..712,719..721) /gene="MSX1" /gene_synonym...
Synonym: CHOX-7; GHOX-7; HOX-7
NM_205488.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus notochord homeobox (NOTO), mRNA. (1736 bp)
gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 304..462 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1736) AUTHORS Knezevic V, Ranson M and Mackem S. TITLE The organizer-associated chick homeobox gene, Gnot1, is expressed before gastrulation and regulated synergistically by activin and retinoic acid JOURNAL Dev. Biol. 171 (2), 458-470 (1995) PUBMED 7556928 REFERENCE 2 (bases 1 to 1736) AUTHORS...
Synonym: CNOT; GNOT1
NM_205354.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus motor neuron and pancreas homeobox 1 (MNX1), mRNA. (1481 bp)
LOCUS NM_204928 1481 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus motor neuron and pancreas homeobox 1 (MNX1), mRNA. ACCESSION NM_204928 VERSION NM_204928.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HLXB9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 577..738 /gene="MNX1" /gene_synonym="HB9; HLXB9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(577..579,586..588,706..708,715..720,727..729) /gene="MNX1" /gene_...
Synonym: HB9; HLXB9
NM_204928.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox 53 (HB53), mRNA. (941 bp)
NA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox,...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9
NM_126068.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus homeobox D13 (HOXD13), mRNA. (1964 bp)
LOCUS NM_205434 1964 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus homeobox D13 (HOXD13), mRNA. ACCESSION NM_205434 XM_429309 VERSION NM_205434.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 719..880 /gene="HOXD13" /gene_synonym="chox-4.8; chox-4G" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(719..721,728..730,848..850,857..862,869..871) /gene="HOXD13" /gene_...
Synonym: chox-4.8; chox-4G
NM_205434.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox 3 (HB-3), mRNA. (1564 bp)
; HOMEOBOX PROTEIN" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 875..991 /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="Homeobox...
NM_121519.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus goosecoid homeobox (GSC), mRNA. (936 bp)
ct="homeobox protein goosecoid" /protein_id="NP_990662.1" /db_xref="CGNC:8338" /db_xref="GeneID:396273" /translation="MPASMFSIDNILAARPRCKDSVLLPPSAPVVFPSLHGDSLYGAASDYGGFYSRAVAPGSALPAVGRSRLGYNNYYYGQLHVATSPVGPSCCGAVPPLGAQQCSCVPPAGYEGAGSVLMSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAQKWNKASKTSPEKRQEDGKSDLDSDS" misc_feature order(451..465,469..471,520..522,538..540,577..579, 583..588,595..600,604..612,616..621) /gene="GSC" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 457..618 /gene="GSC" /note="Homeobox...
NM_205331.1 - Gallus gallus (chicken) - NCBI - UCSC
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 8..75 /gene="HOXA6" /standard_name="Hoxa6" /db_xref="UniSTS:536644" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Gallus gallus homeobox D11 (HOXD11), mRNA. (1006 bp)
LOCUS NM_204620 1006 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus homeobox D11 (HOXD11), mRNA. ACCESSION NM_204620 XM_001234561 VERSION NM_204620.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...GHOX4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 709..870 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(709..711,718..720,838..840,847..852,859..861) /gene="HOXD11" /gene_...
Synonym: GHOX4.6
NM_204620.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus caudal type homeobox 4 (CDX4), mRNA. (1453 bp)
LOCUS NM_204614 1453 bp mRNA linear VRT 27-MAY-2018 DEFINITION Gallus gallus caudal type homeobox 4 (CDX4), mRNA. ACCESSION NM_204614 VERSION NM_204614.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...; other site" /db_xref="CDD:238039" misc_feature 550..708 /gene="CDX4" /gene_synonym="CDXB; CHOX-CAD2; ox-cad2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 524..669 /gene="CDX4" /gene_synonym="CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:...
Synonym: CDXB; CHOX-CAD2; ox-cad2
NM_204614.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (876 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22" /inference="Similar to RNA sequence, EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1" /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1" /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22
NM_179935.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Ovis aries homeobox C6 (HOXC6), mRNA. (1196 bp)
LOCUS NM_001009335 1196 bp mRNA linear MAM 02-JUN-2018 DEFINITION Ovis aries homeobox C6 (HOXC6), mRNA. ACCESSION NM_001009335 VERSION NM_001009335.1 KEYWORDS RefSeq. SOURCE Ovis aries (sheep) ORGANISM Ovis aries Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria;...HOXC6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 199..357 /gene="HOXC6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" STS 58..267 /gene="HOXC6" /standard_name="MARC_44017-44022:1098368610:3" /db_xref="UniSTS...
NM_001009335.1 - Ovis aries (sheep) - NCBI
Rattus norvegicus reproductive homeobox 10 (Rhoxf10), mRNA. (606 bp)
LOCUS NM_001037581 606 bp mRNA linear ROD 25-JUL-2018 DEFINITION Rattus norvegicus reproductive homeobox 10 (Rhoxf10), mRNA. ACCESSION NM_001037581 VERSION NM_001037581.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 295..444 /gene="Rhoxf10" /gene_synonym="Rhox10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..365 /gene="Rhoxf10" /gene_synonym="Rhox10" /inference="alignment:Splign:2.0.8"...
Synonym: Rhox10
NM_001037581.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Strongyloides ratti Homeobox domain and Homeobox KN domain and Homeodomain-like-containing protein (SRAE_2000258700), partial mRNA. (1398 bp)
LOCUS XM_024653672 1398 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Homeobox domain and Homeobox KN domain and Homeodomain-like-containing protein (SRAE_2000258700), partial mRNA. ACCESSION XM_024653672 VERSION XM_024653672.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is...
XM_024653672.1 - Strongyloides ratti - NCBI
PREDICTED: Pelodiscus sinensis homeobox protein Meis3-like (LOC102448310), partial mRNA. (655 bp)
LOCUS XM_014570120 655 bp mRNA linear VRT 04-JUN-2018 DEFINITION PREDICTED: Pelodiscus sinensis homeobox protein Meis3-like (LOC102448310), partial mRNA. ACCESSION XM_014570120 VERSION XM_014570120.1 DBLINK BioProject: PRJNA221645 KEYWORDS RefSeq; includes ab initio. SOURCE Pelodiscus sinensis...Daiwa-1" /db_xref="taxon:13735" /chromosome="Unknown" /sex="female" /country="Japan: Saga" gene 217 /gene="LOC102448310" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:293102" misc_feature 464..562 /gene="LOC102448310" /note="Homeobox KN domain; Region...
XM_014570120.1 - Pelodiscus sinensis (Chinese softshell turtle) - NCBI
Gallus gallus sensory organ homeobox protein SOHo (SOHO-1), mRNA. (1820 bp)
an homeobox protein SOHo" /protein_id="NP_990717.1" /db_xref="CGNC:49762" /db_xref="GeneID:396346" /translation="MVQLGGGRGAPPPLLAPPSAFSIDSILQPGPRCQAREQGRARCALPEDGPAEEHPTKGSTDSGSERLLAEGPRRADAEAEGAVSPLSTERFRGCRQPSLRDTGGCGRESGRCSAAGGKKKTRTIFSKSQVFQLESTFDVKRYLSSAERAGLAAALHLTETQVKIWFQNRRNKLKRQLSAEPEGPGQAEPPGEAASFSFPSLYKDSALFSRCLLPLPFPLFYPGSAIPYLCLPGPVKHFSLLDGDV" misc_feature order(417..431,435..437,486..488,504..506,543..545, 549..554,561..566,570..578,582..587) /gene="SOHO-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 423..584 /gene="SOHO-1" /note="Homeobox...
NM_205386.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus PBX/knotted 1 homeobox 2 (PKNOX2), mRNA. (1434 bp)
LOCUS NM_204226 1434 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus PBX/knotted 1 homeobox 2 (PKNOX2), mRNA. ACCESSION NM_204226 VERSION NM_204226.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...misc_feature 280..531 /gene="PKNOX2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:293102" misc_feature order(862..876,880..882,940..942,958..960,997..999, 1003..1008,1015..1020,1024..1032) /gene="PKNOX2" /note="DNA binding site [nucleotide binding]" /...
NM_204226.1 - Gallus gallus (chicken) - NCBI - UCSC
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Gallus gallus homeobox A6 (HOXA6), mRNA. (1467 bp)
LOCUS NM_001030987 1467 bp mRNA linear VRT 26-JUN-2018 DEFINITION Gallus gallus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001030987 XM_418729 VERSION NM_001030987.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 469..627 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..436 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /inference="alignment:...
Synonym: HOX1; HOX1.2; HOX1B
NM_001030987.2 - Gallus gallus (chicken) - NCBI - UCSC
Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. (2158 bp)
LOCUS NM_001164939 2158 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. ACCESSION NM_001164939 VERSION NM_001164939.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 487..645 /gene="hox6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2158) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164939.1 - Saccoglossus kowalevskii - NCBI
Mus musculus TGFB-induced factor homeobox 2-like, X-linked 2 (Tgif2lx2), mRNA. (1032 bp)
CDS 116..811 /gene="Tgif2lx2" /codon_start=1 /product="TGFB-induced factor homeobox 2-like, X-linked 2" /protein_id="NP_001136222.1" /db_xref="CCDS:CCDS53177.1" /db_xref="GeneID:100039551" /db_xref="MGI:MGI:3800824" /translation="MEEAEGSPEETQDFMKYYSSFGIRLERTCKMKFHDSRELPRGNMLPLKSVKILRDWLCEHQFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHLRWEIRYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNIEKEEKISITEPWSSPEVAWPEEKPDFSSFYMLVDVAVQKAKEMEEQKKQNPNPQGPQQQFM" misc_feature 281..397 /gene="Tgif2lx2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" STS 393..692 /...
NM_001142750.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Esox lucius homeobox B7 (hoxb7), mRNA. (1301 bp)
organism="Esox lucius" /mol_type="mRNA" /db_xref="taxon:8010" /map="LG11" /linkage_group="LG11" gene 1..1301 /gene="hoxb7" /gene_synonym="HXB7A" /note="homeobox B7" /db_xref="GeneID:105013256" exon 1..472 /gene="hoxb7" /gene_synonym="HXB7A" /inference="alignment:Splign:2.1.0" misc_feature 7..9 /gene="hoxb7" /gene_synonym="HXB7A" /note="upstream in-frame stop codon" CDS 82..729 /gene="hoxb7" /gene_synonym="HXB7A" /note="Homeobox protein Hox-B7a" /codon_start=1 /product="homeobox protein Hox-B7" /protein_id="NP_001297778.1" /db_xref="GeneID:105013256" /translation="...
Synonym: HXB7A
NM_001310849.1 - Esox lucius (northern pike) - NCBI
Arabidopsis thaliana homeobox-leucine zipper protein 4 (HB4), mRNA. (1394 bp)
gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 702..854 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 858..989 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8
NM_130055.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.228 | 0.228 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.325 | 0.097 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.331 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]