GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-05-22 03:47:53, GGRNA : RefSeq release 210 (Jan, 2022)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1770 bp)
LOCUS NM_006562 1770 bp mRNA linear PRI 24-SEP-2021 DEFINITION Homo sapiens ladybird homeobox 1 (LBX1), mRNA. ACCESSION NM_006562 VERSION NM_006562.5 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL135794.19. On Sep 30, 2020 this sequence version replaced NM_006562.4. Summary: This gene and...
Synonym: CCHS3; homeobox; HPX-6; HPX6; LBX1H
NM_006562.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="propagated from UniProtKB/Swiss-Prot (Q01703.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (583 bp)
LOCUS NR_131758 583 bp RNA linear ROD 18-OCT-2021 DEFINITION Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_131758 VERSION NR_131758.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT PREDICTED REFSEQ: This record has not been reviewed and the function is unknown. The reference sequence was derived from AK002860.1. ##Evidence-...
Synonym: 0610040B09Rik; AV302770; Hoxb5/6as
NR_131758.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 328..1018 /gene="HMX1" /gene_synonym="GH6" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL...
Synonym: GH6
NM_205533.3 - Gallus gallus (chicken) - NCBI - UCSC
Homo sapiens tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 3, mRNA. (523 bp)
tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 3, mRNA. ACCESSION NM_001397349 VERSION NM_001397349.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC024582.7. On Nov 10, 2021 this sequence version replaced NM_001397349.1. Summary: Homeobox genes encode DNA-binding proteins...
Synonym: TPRX2P; TPRX2P1; TPRXP1
NM_001397349.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 1, mRNA. (1127 bp)
repeat homeobox 2 (TPRX2), transcript variant 1, mRNA. ACCESSION NM_001397347 VERSION NM_001397347.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC024582.7. On Nov 10, 2021 this sequence version replaced NM_001397347.1. Summary: Homeobox genes encode DNA-binding...
Synonym: TPRX2P; TPRX2P1; TPRXP1
NM_001397347.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 2, mRNA. (1032 bp)
tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 2, mRNA. ACCESSION NM_001397348 VERSION NM_001397348.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC024582.7. On Nov 10, 2021 this sequence version replaced NM_001397348.1. Summary: Homeobox genes encode DNA-binding proteins...
Synonym: TPRX2P; TPRX2P1; TPRXP1
NM_001397348.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Gallus gallus H6 family homeobox 3 (HMX3), mRNA. (1487 bp)
LOCUS NM_001007985 1487 bp mRNA linear VRT 18-NOV-2021 DEFINITION Gallus gallus H6 family homeobox 3 (HMX3), mRNA. ACCESSION NM_001007985 XM_426755 VERSION NM_001007985.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NKX5-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 743..907 /gene="HMX3" /gene_synonym="NKX5-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(743..745,752..754,872..874,881..886,893..895) /gene="HMX3" /gene_synonym...
Synonym: NKX5-1
NM_001007985.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D12 (HOXD12), mRNA. (1332 bp)
LOCUS NM_205249 1332 bp mRNA linear VRT 04-DEC-2021 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 608..769 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(608..610,617..619,737..739,746..751,758..760) /gene="HOXD12" /note="specific DNA base...
NM_205249.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox A6 (HOXA6), transcript variant 2, mRNA. (880 bp)
LOCUS NM_001398309 880 bp mRNA linear VRT 14-DEC-2021 DEFINITION Gallus gallus homeobox A6 (HOXA6), transcript variant 2, mRNA. ACCESSION NM_001398309 VERSION NM_001398309.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived...
Synonym: HOX1; HOX1.2; HOX1B
NM_001398309.1 - Gallus gallus (chicken) - NCBI - UCSC
Homo sapiens tetrapeptide repeat homeobox 1 (TPRX1), transcript variant 2, mRNA. (2070 bp)
collaboration with Anne Booth and Peter Holland. The reference sequence was derived from AC008745.7. On Jul 13, 2021 this sequence version replaced NM_198479.2. Summary: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the TPRX homeobox gene family. [provided by RefSeq, Jul 2008]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the...
Synonym: TPRX
NM_198479.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox A5 (HOXA5), mRNA. (1677 bp)
LOCUS NM_001318419 1677 bp mRNA linear VRT 04-DEC-2021 DEFINITION Gallus gallus homeobox A5 (HOXA5), mRNA. ACCESSION NM_001318419 XM_003640699 VERSION NM_001318419.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...; Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 538..>858 /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="Homeobox protein; Region: Abdominal-A; cl27820" /db_xref="CDD:332641" misc_feature 604..621 /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="propagated...
Synonym: HOX1.3; HOX1C
NM_001318419.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus msh homeobox 2 (MSX2), mRNA. (2289 bp)
LOCUS NM_204559 2289 bp mRNA linear VRT 23-SEP-2021 DEFINITION Gallus gallus msh homeobox 2 (MSX2), mRNA. ACCESSION NM_204559 VERSION NM_204559.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 494..658 /gene="MSX2" /gene_synonym="HOX-8; Msx-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(494..496,503..505,623..625,632..637,644..646) /gene="MSX2" /gene_synonym="...
Synonym: HOX-8; Msx-2
NM_204559.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox A6 (HOXA6), transcript variant 1, mRNA. (823 bp)
LOCUS NM_001030987 823 bp mRNA linear VRT 14-DEC-2021 DEFINITION Gallus gallus homeobox A6 (HOXA6), transcript variant 1, mRNA. ACCESSION NM_001030987 XM_418729 VERSION NM_001030987.4 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata;...contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 560..718 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 725..784 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="...
Synonym: HOX1; HOX1.2; HOX1B
NM_001030987.4 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D8 (HOXD8), mRNA. (1251 bp)
db_xref="CDD:238039" misc_feature 462..623 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 621..731 /gene="HOXD8" /note="propagated from UniProtKB/Swiss-Prot (P23459.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 291..438 /gene="HOXD8" /inference="alignment:Splign:2.1.0" exon 439..1251 /gene="HOXD8" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1251) AUTHORS Crompton MR, MacGregor AD and Goodwin GH. TITLE cDNA cloning of a homeobox-containing gene expressed in avian myeloblastic virus-transformed...
NM_207177.2 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus homeo box C6 (Hoxc6), mRNA. (1680 bp)
Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000187.1. On Dec 20, 2021 this sequence version replaced XM_003750415.5. Summary: member of the homeobox family [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: BP504517.1, AI502511.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-527...
NM_001398518.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. (2247 bp)
LOCUS NM_001005427 2247 bp mRNA linear VRT 23-SEP-2021 DEFINITION Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. ACCESSION NM_001005427 XM_418692 VERSION NM_001005427.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...MEOX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 854..1015 /gene="MEOX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 801..973 /gene="MEOX2" /inference="alignment:Splign:2.1.0" exon 974..2247 /gene="...
NM_001005427.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (892 bp)
LOCUS NM_204990 892 bp mRNA linear VRT 04-DEC-2021 DEFINITION Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. ACCESSION NM_204990 VERSION NM_204990.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from...
Synonym: CMIX
NM_204990.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus msh homeobox 1 (MSX1), mRNA. (1326 bp)
LOCUS NM_205488 1326 bp mRNA linear VRT 03-OCT-2021 DEFINITION Gallus gallus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_205488 XM_444660 VERSION NM_205488.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 582..743 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(582..584,591..593,711..713,720..725,732..734) /gene="MSX1" /gene_synonym...
Synonym: CHOX-7; GHOX-7; HOX-7
NM_205488.3 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus caudal type homeobox 4 (CDX4), mRNA. (2614 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 586..731 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" exon 732..2614 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2614) AUTHORS Joshi P, Darr AJ and Skromne I. TITLE CDX4 regulates the progression of neural maturation in the spinal cord JOURNAL Dev Biol 449 (2), 132-142 (2019) PUBMED 30825428 REMARK GeneRIF: Results show that in the spinal cord, caudal type homeobox 4 (CDX4) is...
Synonym: cCdx-B; CDXB; CHOX-CAD2; ox-cad2
NM_204614.2 - Gallus gallus (chicken) - NCBI - UCSC
Homo sapiens tetrapeptide repeat homeobox 1 (TPRX1), transcript variant 1, mRNA. (1956 bp)
DEFINITION Homo sapiens tetrapeptide repeat homeobox 1 (TPRX1), transcript variant 1, mRNA. ACCESSION NM_001397346 VERSION NM_001397346.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC008745.7. Summary: Homeobox genes encode DNA-binding proteins, many of which are...
Synonym: TPRX
NM_001397346.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. (2493 bp)
TLX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(959..961,968..970,1088..1090,1097..1102,1109..1111) /gene="TLX1" /gene_synonym="TLX-1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 918..1119 /gene="TLX1" /gene_synonym="TLX-1" /inference="alignment:Splign:2.1.0" exon 1120..2493 /gene="TLX1" /gene_synonym="TLX-1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2493) AUTHORS Logan C, Wingate RJ, McKay IJ and Lumsden A. TITLE Tlx-1 and Tlx-3 homeobox gene expression in...
Synonym: TLX-1
NM_205015.2 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus laevis engrailed homeobox 1 L homeolog (en1.L), mRNA. (1465 bp)
engrailed-1; xen1" /note="engrailed homeobox 1 L homeolog" /db_xref="GeneID:735177" /db_xref="Xenbase:XB-GENE-6254268" exon 1..584 /gene="en1.L" /gene_synonym="en-1; En-1A; en1-a; en1-b; en1a; eng1; engrailed-1; xen1" /inference="alignment:Splign:2.1.0" misc_feature 104..106 /gene="en1.L" /gene_synonym="en-1; En-1A; en1-a; en1-b; en1a; eng1; engrailed-1; xen1" /note="upstream in-frame stop codon" CDS 215..904 /gene="en1.L" /gene_synonym="en-1; En-1A; en1-a; en1-b; en1a; eng1; engrailed-1; xen1" /note="engrailed 1; En-1a homeobox protein; Homeobox protein en-1-A" /codon_start=1 /product="...
Synonym: en-1; En-1A; en1-a; en1-b; en1a; eng1; engrailed-1; xen1
NM_001096633.1 - Xenopus laevis (African clawed frog) - NCBI
Gallus gallus homeobox D11 (HOXD11), mRNA. (1528 bp)
LOCUS NM_204620 1528 bp mRNA linear VRT 04-DEC-2021 DEFINITION Gallus gallus homeobox D11 (HOXD11), mRNA. ACCESSION NM_204620 XM_001234561 VERSION NM_204620.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...GHOX4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 704..865 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(704..706,713..715,833..835,842..847,854..856) /gene="HOXD11" /gene_...
Synonym: GHOX4.6
NM_204620.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus notochord homeobox (NOTO), transcript variant 2, mRNA. (2078 bp)
specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 320..481 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 440..2078 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2078) AUTHORS Knezevic V, Ranson M and Mackem S. TITLE The organizer-associated chick homeobox gene, Gnot1, is expressed before gastrulation and regulated synergistically by activin and retinoic acid JOURNAL Dev Biol 171 (2), 458-470 (1995) PUBMED...
Synonym: CNOT; GNOT1
NM_001389306.2 - Gallus gallus (chicken) - NCBI - UCSC
Mus musculus reproductive homeobox 9 (Rhox9), mRNA. (898 bp)
LOCUS NM_023894 898 bp mRNA linear ROD 14-OCT-2021 DEFINITION Mus musculus reproductive homeobox 9 (Rhox9), mRNA. ACCESSION NM_023894 VERSION NM_023894.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 551..712 /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpbox; Psx2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(551..553,560..562,680..682,689..694,701..703) /gene="Rhox9" /gene_...
Synonym: 1600026O01Rik; Gpbox; Psx2
NM_023894.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus notochord homeobox (NOTO), transcript variant 1, mRNA. (2062 bp)
other site" /db_xref="CDD:238039" misc_feature 304..465 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 215..423 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /inference="alignment:Splign:2.1.0" exon 424..2062 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2062) AUTHORS Knezevic V, Ranson M and Mackem S. TITLE The organizer-associated chick homeobox gene, Gnot1, is expressed before gastrulation and regulated synergistically by activin and retinoic acid JOURNAL Dev...
Synonym: CNOT; GNOT1
NM_001396848.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus notochord homeobox (NOTO), transcript variant 3, non-coding RNA. (1742 bp)
LOCUS NR_171275 1742 bp RNA linear VRT 26-OCT-2021 DEFINITION Gallus gallus notochord homeobox (NOTO), transcript variant 3, non-coding RNA. ACCESSION NR_171275 VERSION NR_171275.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was...
Synonym: CNOT; GNOT1
NR_171275.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus VENT homeobox (VENTX), mRNA. (1652 bp)
LOCUS NM_001391909 1652 bp mRNA linear VRT 03-DEC-2021 DEFINITION Gallus gallus VENT homeobox (VENTX), mRNA. ACCESSION NM_001391909 XM_015288825 VERSION NM_001391909.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from...
NM_001391909.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox C9 (HOXC9), mRNA. (938 bp)
LOCUS NM_001277282 938 bp mRNA linear VRT 15-DEC-2021 DEFINITION Gallus gallus homeobox C9 (HOXC9), mRNA. ACCESSION NM_001277282 XM_423451 VERSION NM_001277282.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from...
NM_001277282.2 - Gallus gallus (chicken) - NCBI - UCSC
Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. (1144 bp)
LOCUS NM_010420 1144 bp mRNA linear ROD 16-OCT-2021 DEFINITION Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. ACCESSION NM_010420 VERSION NM_010420.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata;...Rpx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 689..853 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order(689..691,698..700,818..820,827..832,839..841) /gene="Hesx1" /gene_...
Synonym: HES-1; Rpx
NM_010420.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox B6 (HOXB6), mRNA. (1741 bp)
db_xref="taxon:9031" /chromosome="27" /map="27" /breed="Leghorn" gene 1..1741 /gene="HOXB6" /gene_synonym="GHOX-2.2" /note="homeobox B6" /db_xref="CGNC:59035" /db_xref="GeneID:777548" exon 1..736 /gene="HOXB6" /gene_synonym="GHOX-2.2" /inference="alignment:Splign:2.1.0" misc_feature 259..261 /gene="HOXB6" /gene_synonym="GHOX-2.2" /note="upstream in-frame stop codon" CDS 328..996 /gene="HOXB6" /gene_synonym="GHOX-2.2" /note="homeobox protein Hox-B6-like; Homeobox protein Hox-2.2" /codon_start=1 /product="homeobox protein Hox-B6" /protein_id="NP_001383565.1" /db_xref="CGNC:59035" /db_xref="...
Synonym: GHOX-2.2
NM_001396636.1 - Gallus gallus (chicken) - NCBI - UCSC
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_053630) mRNA, complete cds. (747 bp)
locus_tag="EIN_053630" /note="encoded by transcript EIN_053630A" /codon_start=1 /product="homeobox protein knotted-1, putative" /protein_id="XP_004259889.1" /db_xref="GeneID:14892326" /translation="MEPTQEVQKVLTECVNKTIDFDQYLKCFEQSLVRPSGDISDQSLMEKVQHVADLVTGEKLLRLNELVQIFNSQAEVLYLYYTSYYTQLVSLLDSQSQKRIVTQDERSYKISCLRALFGNIYSHLKLMFGSNVSSLAPRERKIPTFLSPQISVHSITSQSQPLSKITCKNSLVLSSTKPTKPIFKIDKIKTQSPKTQKIKPLLDWFVLHSNHPYPTEEQKERLGSECGMSPKQVGTWFSNKRNRNKNQN" misc_feature 610..711 /locus_tag="EIN_053630" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1...
XM_004259841.1 - Entamoeba invadens IP1 - NCBI
Mus musculus reproductive homeobox 7A (Rhox7a), mRNA. (983 bp)
reproductive homeobox on chromosome X, 7" /codon_start=1 /product="reproductive homeobox 7" /protein_id="NP_001020257.2" /db_xref="CCDS:CCDS30081.1" /db_xref="GeneID:547168" /db_xref="MGI:MGI:3580246" /translation="METMFQETQYPDVLTREVLARSMDGSEAKVQIRFNNRRAKQRAREKKAMLRSTAGAKAPLVLPAGEERNGEDSRDQSSPGLGASAAEWGGVEGPGELGRKEKNGASPSAVDTSGVRGDWTQKGASGSSQKNERRPQNRVPECRWGTEDVHPVPVLVPRAQRRQRVGSRSRGQSVSLKCPRIRPVLVSTVQPVPVLVPHRPLRDGFTEPQLQELEQVFQRNHYLRAEEGKQLARGTGVTEAKLQRWFKKRRVQFRREHSQSRMNDDAPPRTHSTSLKMAQEP" misc_feature <138..263 /gene="Rhox7a" /gene_synonym="Gm712; Rhox7" /note="Homeobox domain; Region:...
Synonym: Gm712; Rhox7
NM_001025086.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Haplochromis burtoni homeobox protein Dlx4a-like (dlx4a), mRNA. (2002 bp)
FEATURES Location/Qualifiers source 1..2002 /organism="Haplochromis burtoni" /mol_type="mRNA" /db_xref="taxon:8153" gene 1..2002 /gene="dlx4a" /note="homeobox protein Dlx4a-like" /db_xref="GeneID:102299128" exon 1..824 /gene="dlx4a" /inference="alignment:Splign:2.1.0" misc_feature 302..304 /gene="dlx4a" /note="upstream in-frame stop codon" CDS 488..1264 /gene="dlx4a" /note="distal-less homeobox protein 4a" /codon_start=1 /product="Homeobox protein Dlx4a" /protein_id="NP_001273266.1" /db_xref="GeneID:102299128" /translation="...
NM_001286337.1 - Haplochromis burtoni (Burton's mouthbrooder) - NCBI
Salmo salar homeobox A5a (hoxa5a), mRNA. (1506 bp)
LOCUS NM_001139568 1506 bp mRNA linear VRT 22-NOV-2021 DEFINITION Salmo salar homeobox A5a (hoxa5a), mRNA. ACCESSION NM_001139568 VERSION NM_001139568.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...; other site" /db_xref="CDD:238039" misc_feature 1163..1321 /gene="hoxa5a" /gene_synonym="hoxa5; hoxa5ab; S12-B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1131..1506 /gene="hoxa5a" /gene_synonym="hoxa5; hoxa5ab; S12-B" /inference="alignment:...
Synonym: hoxa5; hoxa5ab; S12-B
NM_001139568.1 - Salmo salar (Atlantic salmon) - NCBI
PREDICTED: Xenopus laevis pituitary homeobox 3-like [provisional] L homeolog (homeobox100496651-provisional.L), mRNA. (1350 bp)
LOCUS XM_018225529 1350 bp mRNA linear VRT 14-MAY-2021 DEFINITION PREDICTED: Xenopus laevis pituitary homeobox 3-like [provisional] L homeolog (homeobox100496651-provisional.L), mRNA. ACCESSION XM_018225529 VERSION XM_018225529.2 DBLINK BioProject: PRJNA338693 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_018225529.2 - Xenopus laevis (African clawed frog) - NCBI
Zea mays Homeobox-leucine zipper protein ATHB-12 (LOC100193808), mRNA. (1412 bp)
map="2" gene 1..1412 /gene="LOC100193808" /gene_synonym="GRMZM2G034113" /note="Homeobox-leucine zipper protein ATHB-12" /db_xref="GeneID:100193808" exon 1..691 /gene="LOC100193808" /gene_synonym="GRMZM2G034113" /inference="alignment:Splign:2.1.0" misc_feature 296..298 /gene="LOC100193808" /gene_synonym="GRMZM2G034113" /note="upstream in-frame stop codon" CDS 341..1075 /gene="LOC100193808" /gene_synonym="GRMZM2G034113" /note="homeodomain-leucine zipper transcription factor TaHDZipI-1; putative homeobox DNA-binding and leucine zipper domain family protein" /codon_start=1 /product="Homeobox-...
Synonym: GRMZM2G034113
NM_001156038.2 - Zea mays - NCBI
Gallus gallus homeobox B1 (HOXB1), transcript variant 1, mRNA. (2163 bp)
LOCUS NM_001080859 2163 bp mRNA linear VRT 14-DEC-2021 DEFINITION Gallus gallus homeobox B1 (HOXB1), transcript variant 1, mRNA. ACCESSION NM_001080859 XM_001234950 VERSION NM_001080859.5 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 768..926 /gene="HOXB1" /gene_synonym="Ghox-lab; HOXB-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(774..776,894..896,903..908,915..917) /gene="HOXB1" /gene_synonym="Ghox...
Synonym: Ghox-lab; HOXB-1
NM_001080859.5 - Gallus gallus (chicken) - NCBI - UCSC
Felis catus Nanog homeobox (NANOG), mRNA. (936 bp)
LOCUS NM_001173442 936 bp mRNA linear MAM 14-NOV-2021 DEFINITION Felis catus Nanog homeobox (NANOG), mRNA. ACCESSION NM_001173442 VERSION NM_001173442.1 KEYWORDS RefSeq. SOURCE Felis catus (domestic cat) ORGANISM Felis catus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia...NANOG" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 298..456 /gene="NANOG" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..151 /gene="NANOG" /inference="alignment:Splign:2.1.0" exon 152..417 /gene="NANOG" /...
NM_001173442.1 - Felis catus (domestic cat) - NCBI
Mus musculus paired related homeobox 2 (Prrx2), mRNA. (1150 bp)
LOCUS NM_009116 1150 bp mRNA linear ROD 28-DEC-2021 DEFINITION Mus musculus paired related homeobox 2 (Prrx2), mRNA. ACCESSION NM_009116 XM_979268 VERSION NM_009116.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata;...Prot (Q06348.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 375..530 /gene="Prrx2" /gene_synonym="Prx2; S8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(378..380,498..500,507..512,519..521) /gene="Prrx2" /gene_synonym="...
Synonym: Prx2; S8
NM_009116.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus HESX homeobox 1 (HESX1), mRNA. (1379 bp)
LOCUS NM_205012 1379 bp mRNA linear VRT 03-DEC-2021 DEFINITION Gallus gallus HESX homeobox 1 (HESX1), mRNA. ACCESSION NM_205012 VERSION NM_205012.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000252.1. On...
Synonym: GANF
NM_205012.3 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox B1 (HOXB1), transcript variant 3, mRNA. (3780 bp)
LOCUS NM_001397963 3780 bp mRNA linear VRT 14-DEC-2021 DEFINITION Gallus gallus homeobox B1 (HOXB1), transcript variant 3, mRNA. ACCESSION NM_001397963 VERSION NM_001397963.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived...
Synonym: Ghox-lab; HOXB-1
NM_001397963.1 - Gallus gallus (chicken) - NCBI - UCSC
Mus musculus H6 homeobox 2 (Hmx2), transcript variant 1, mRNA. (2870 bp)
LOCUS NM_145998 2870 bp mRNA linear ROD 16-OCT-2021 DEFINITION Mus musculus H6 homeobox 2 (Hmx2), transcript variant 1, mRNA. ACCESSION NM_145998 VERSION NM_145998.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 468..629 /gene="Hmx2" /gene_synonym="Nkx-5.2; Nkx5-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(468..470,477..479,597..599,606..611,618..620) /gene="Hmx2" /gene_synonym...
Synonym: Nkx-5.2; Nkx5-2
NM_145998.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus homeobox A6 (Hoxa6), mRNA. (2254 bp)
LOCUS NM_010454 2254 bp mRNA linear ROD 25-OCT-2021 DEFINITION Mus musculus homeobox A6 (Hoxa6), mRNA. ACCESSION NM_010454 VERSION NM_010454.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..678 /gene="Hoxa6" /gene_synonym="Hox-1.2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 488..2254 /gene="Hoxa6" /gene_synonym="Hox-1.2" /inference="alignment:Splign:2.1.0"...
Synonym: Hox-1.2
NM_010454.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus homeobox D8 (Hoxd8), transcript variant 3, mRNA. (1683 bp)
LOCUS NM_001290731 1683 bp mRNA linear ROD 25-OCT-2021 DEFINITION Mus musculus homeobox D8 (Hoxd8), transcript variant 3, mRNA. ACCESSION NM_001290731 VERSION NM_001290731.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...; other site" /db_xref="CDD:238039" misc_feature 282..440 /gene="Hoxd8" /gene_synonym="4921540P06Rik; AI047735; Hox-4.3; Hox-5.4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 259..1678 /gene="Hoxd8" /gene_synonym="4921540P06Rik; AI047735; Hox-4.3; Hox...
Synonym: 4921540P06Rik; AI047735; Hox-4.3; Hox-5.4
NM_001290731.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Danio rerio visual system homeobox 1 homolog, chx10-like (vsx1), mRNA. (1587 bp)
LOCUS NM_131333 1587 bp mRNA linear VRT 12-DEC-2021 DEFINITION Danio rerio visual system homeobox 1 homolog, chx10-like (vsx1), mRNA. ACCESSION NM_131333 VERSION NM_131333.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="vsx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 490..651 /gene="vsx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(490..492,499..501,619..621,628..633,640..642) /gene="vsx1" /note="specific DNA base...
NM_131333.1 - Danio rerio (zebrafish) - NCBI - UCSC
PREDICTED: Cervus elaphus distal-less homeobox 5 (DLX5), mRNA. (1530 bp)
db_xref="GeneID:122673803" CDS 290..1159 /gene="DLX5" /codon_start=1 /product="homeobox protein DLX-5" /protein_id="XP_043727609.1" /db_xref="GeneID:122673803" /translation="MTGVFDRRVPSIRSGDFQAPFQTAAAMHHPSQESPTLPESSATDSDYYSAPGGAPHGYCSPTSASYGKALNPYQYQYHGVTGSAGSYPAKAYADYGYASPYHQYGGAYNRVPSAASQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY" misc_feature 383..643 /gene="DLX5" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="CDD...
XM_043871674.1 - Cervus elaphus (red deer) - NCBI
Xenopus laevis homeobox C5 L homeolog (hoxc5.L), mRNA. (1837 bp)
LOCUS NM_001085822 1837 bp mRNA linear VRT 21-NOV-2021 DEFINITION Xenopus laevis homeobox C5 L homeolog (hoxc5.L), mRNA. ACCESSION NM_001085822 VERSION NM_001085822.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata;...binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 535..696 /gene="hoxc5.L" /gene_synonym="hoxc5; hoxc5-A; XlHbox5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(535..537,544..546,664..666,673..678,685..687) /gene="hoxc5.L" /gene_...
Synonym: hoxc5; hoxc5-A; XlHbox5
NM_001085822.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Cervus elaphus engrailed homeobox 2 (EN2), mRNA. (1897 bp)
CDS 488..1462 /gene="EN2" /codon_start=1 /product="homeobox protein engrailed-2" /protein_id="XP_043729436.1" /db_xref="GeneID:122674889" /translation="MEENDPKPSEAAAAEGQRPPECSPSGGAGSPGEADTGRRRALMLPAVLQAPGNHQHPHRITNFFIDNILRPEFGRRKDAGTCCPGAGGGRGAGAGGEGGLEGGGGAGGAEQLLVSGREPRQNAPGAPGAGGPLPGGGGSDSPGDGEGGSKALSLHSGAKKGGDPGGPLDGALKARGLGGGDLSVSSDSDSSQASANLGAQPMLWPAWVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKKATGSKNTLAVHLMAQGLYNHSTTAKEGKSDSE" misc_feature 1199..1363 /gene="EN2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_...
XM_043873501.1 - Cervus elaphus (red deer) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/homeobox
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.230 | 0.230 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.420 | 0.190 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.426 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]