2025-07-12 09:38:46, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_022175 794 bp mRNA linear ROD 30-MAR-2024 DEFINITION Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. ACCESSION NM_022175 XM_039099478 VERSION NM_022175.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 794) AUTHORS MacLean,J.A. 2nd, Hayashi,K., Turner,T.T. and Wilkinson,M.F. TITLE The Rhox5 homeobox gene regulates the region-specific expression of its paralogs in the rodent epididymis JOURNAL Biol Reprod 86 (6), 189 (2012) PUBMED 22423045 REMARK GeneRIF: regulates the expression of other Rhox genes in the epididymis Publication Status: Online-Only REFERENCE 2 (bases 1 to 794) AUTHORS Bhardwaj,A., Song,H.W., Beildeck,M., Kerkhofs,S., Castoro,R., Shanker,S., De Gendt,K., Suzuki,K., Claessens,F., Issa,J.P., Orgebin-Crist,M.C. and Wilkinson,M.F. TITLE DNA demethylation-dependent AR recruitment and GATA factors drive Rhox5 homeobox gene transcription in the epididymis JOURNAL Mol Endocrinol 26 (4), 538-549 (2012) PUBMED 22322598 REMARK GeneRIF: GATA factors collaborate to dictate the unique developmental and region-specific expression pattern of the RHOX5 homeobox transcription factor in the caput epididymis. REFERENCE 3 (bases 1 to 794) AUTHORS MacLean,J.A. 2nd, Rao,M.K., Doyle,K.M., Richards,J.S. and Wilkinson,M.F. TITLE Regulation of the Rhox5 homeobox gene in primary granulosa cells: preovulatory expression and dependence on SP1/SP3 and GABP JOURNAL Biol Reprod 73 (6), 1126-1134 (2005) PUBMED 16093360 REMARK GeneRIF: expression in the ovary is governed by the distal promoter and is expressed at least as early as Day 5 postpartum. mRNA levels are regulated during the ovarian cycle, peaking before ovulation REFERENCE 4 (bases 1 to 794) AUTHORS Rao,M.K., Maiti,S., Ananthaswamy,H.N. and Wilkinson,M.F. TITLE A highly active homeobox gene promoter regulated by Ets and Sp1 family members in normal granulosa cells and diverse tumor cell types JOURNAL J Biol Chem 277 (29), 26036-26045 (2002) PUBMED 11986330 REMARK GeneRIF: Pem promoter may be a useful model system to understand the molecular mechanism by which a tissue-specific promoter can be corrupted in tumor cells REFERENCE 5 (bases 1 to 794) AUTHORS Maiti,S., Doskow,J., Li,S., Nhim,R.P., Lindsey,J.S. and Wilkinson,M.F. TITLE The Pem homeobox gene. Androgen-dependent and -independent promoters and tissue-specific alternative RNA splicing JOURNAL J Biol Chem 271 (29), 17536-17546 (1996) PUBMED 8663309 REFERENCE 6 (bases 1 to 794) AUTHORS Maiti,S., Doskow,J., Sutton,K., Nhim,R.P., Lawlor,D.A., Levan,K., Lindsey,J.S. and Wilkinson,M.F. TITLE The Pem homeobox gene: rapid evolution of the homeodomain, X chromosomal localization, and expression in reproductive tissue JOURNAL Genomics 34 (3), 304-316 (1996) PUBMED 8786129 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAXUCZ010000021.1. On or before May 21, 2021 this sequence version replaced XM_039099478.1, NM_022175.1. ##Evidence-Data-START## Transcript exon combination :: FQ228987.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760434, SAMN06621351 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on expression ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-32 JAXUCZ010000021.1 121402049-121402080 33-93 JAXUCZ010000021.1 121403020-121403080 94-175 JAXUCZ010000021.1 121403724-121403805 176-527 JAXUCZ010000021.1 121403973-121404324 528-573 JAXUCZ010000021.1 121404932-121404977 574-794 JAXUCZ010000021.1 121407423-121407643 FEATURES Location/Qualifiers source 1..794 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="X" /map="Xq35" gene 1..794 /gene="Rhox5" /gene_synonym="Pem" /note="Rhox homeobox family member 5" /db_xref="GeneID:24631" /db_xref="RGD:3295" exon 1..32 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" exon 33..93 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" misc_feature 58..60 /gene="Rhox5" /gene_synonym="Pem" /note="upstream in-frame stop codon" exon 94..175 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" CDS 97..723 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.2" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="
MEAQGSSHDISRLLCLGVKEDSEEQHDVKAEAFFQAGEGRDEKGAQGQPGEGAVGTEGEGEELNGGEGHFGPGVPGPVGEGDKDGGTRASGMEEEQHEPVAEGTESVKSEDKQMPLRRPGSTQRRLAELERILLSSGSSSGPTWEELDRWMDISVSRVQNWFKIRRAAYRRNRRRRTPIPEHFRATSGCPACLGARWGVRCPFATPRF"
exon 176..527 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" exon 528..573 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" exon 574..794 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" ORIGIN
atattttggagagagaaaagccaagcagccatccttcaagatcacctcctgtattcctagctggacaagaggaaacacaaagagaaccatccagatatggaggctcaaggctctagccatgatatcagccgcttactctgcctgggagtcaaggaagactcggaagaacagcatgatgtgaaagcagaggctttctttcaggctggagaggggagagacgagaaaggtgcacagggtcagcctggagagggagcagtgggaacagaaggcgaaggagaagaattaaatggaggagaaggccactttggtcctggtgttccaggtcctgtgggtgagggggacaaggatggtggcaccagagctagtggcatggaggaggagcaacatgagcccgttgccgagggcactgagagtgtcaagtctgaggataagcagatgccactccgccgccctgggtccacccagcggcggctggcggaattggagcgcattttgctaagcagtggttcctccagtggcccaacatgggaggagcttgatagatggatggatatcagtgtgtccagagtgcagaattggtttaagattaggagggctgcatacagaagaaataggaggcggagaacaccaatccctgaacattttagagcaacatctgggtgccctgcttgtcttggagcaagatggggagtaagatgtccttttgcaacaccgagattttgatcacatatgccagccatgacaactcttgcctttcaacaattctgtcagcaataaagaaatgattctcagta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]