GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-26 15:12:02, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       NM_131272               2029 bp    mRNA    linear   VRT 21-OCT-2018
DEFINITION  Danio rerio muscle segment homeobox 3 (msx3), mRNA.
ACCESSION   NM_131272
VERSION     NM_131272.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Cyprinidae; Danio.
REFERENCE   1  (bases 1 to 2029)
  AUTHORS   Pinto RA, Almeida-Santos J, Lourenco R and Saude L.
  TITLE     Identification of Dmrt2a downstream genes during zebrafish early
            development using a timely controlled approach
  JOURNAL   BMC Dev. Biol. 18 (1), 14 (2018)
   PUBMED   29914374
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2029)
  AUTHORS   Murciano C, Cazorla-Vazquez S, Gutierrez J, Hijano JA, Ruiz-Sanchez
            J, Mesa-Almagro L, Martin-Reyes F, Fernandez TD and Mari-Beffa M.
  TITLE     Widening control of fin inter-rays in zebrafish and inferences
            about actinopterygian fins
  JOURNAL   J. Anat. 232 (5), 783-805 (2018)
   PUBMED   29441573
REFERENCE   3  (bases 1 to 2029)
  AUTHORS   Ando K, Shibata E, Hans S, Brand M and Kawakami A.
  TITLE     Osteoblast Production by Reserved Progenitor Cells in Zebrafish
            Bone Regeneration and Maintenance
  JOURNAL   Dev. Cell 43 (5), 643-650 (2017)
   PUBMED   29103952
REFERENCE   4  (bases 1 to 2029)
  AUTHORS   Tornini VA, Puliafito A, Slota LA, Thompson JD, Nachtrab G, Kaushik
            AL, Kapsimali M, Primo L, Di Talia S and Poss KD.
  TITLE     Live Monitoring of Blastemal Cell Contributions during Appendage
            Regeneration
  JOURNAL   Curr. Biol. 26 (22), 2981-2991 (2016)
   PUBMED   27839971
REFERENCE   5  (bases 1 to 2029)
  AUTHORS   Shibata E, Yokota Y, Horita N, Kudo A, Abe G, Kawakami K and
            Kawakami A.
  TITLE     Fgf signalling controls diverse aspects of fin regeneration
  JOURNAL   Development 143 (16), 2920-2929 (2016)
   PUBMED   27402707
REFERENCE   6  (bases 1 to 2029)
  AUTHORS   Ekker M, Akimenko MA, Allende ML, Smith R, Drouin G, Langille RM,
            Weinberg ES and Westerfield M.
  TITLE     Relationships among msx gene structure and function in zebrafish
            and other vertebrates
  JOURNAL   Mol. Biol. Evol. 14 (10), 1008-1022 (1997)
   PUBMED   9335141
REFERENCE   7  (bases 1 to 2029)
  AUTHORS   Riley BB and Grunwald DJ.
  TITLE     A mutation in zebrafish affecting a localized cellular function
            required for normal ear development
  JOURNAL   Dev. Biol. 179 (2), 427-435 (1996)
   PUBMED   8903357
REFERENCE   8  (bases 1 to 2029)
  AUTHORS   Hyatt GA, Schmitt EA, Marsh-Armstrong N, McCaffery P, Drager UC and
            Dowling JE.
  TITLE     Retinoic acid establishes ventral retinal characteristics
  JOURNAL   Development 122 (1), 195-204 (1996)
   PUBMED   8565830
REFERENCE   9  (bases 1 to 2029)
  AUTHORS   Macdonald R, Barth KA, Xu Q, Holder N, Mikkola I and Wilson SW.
  TITLE     Midline signalling is required for Pax gene regulation and
            patterning of the eyes
  JOURNAL   Development 121 (10), 3267-3278 (1995)
   PUBMED   7588061
REFERENCE   10 (bases 1 to 2029)
  AUTHORS   Akimenko MA, Johnson SL, Westerfield M and Ekker M.
  TITLE     Differential induction of four msx homeobox genes during fin
            development and regeneration in zebrafish
  JOURNAL   Development 121 (2), 347-357 (1995)
   PUBMED   7768177
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL831745.3, EH593082.1, DT069743.1 and EH607545.1.
            On Aug 18, 2015 this sequence version replaced NM_131272.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: GFIL01027003.1, BC071302.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2168446, SAMEA2168447
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-43                AL831745.3         96015-96057
            44-925              EH593082.1         49-930
            926-1334            DT069743.1         224-632
            1335-2026           EH607545.1         1-692               c
            2027-2029           AL831745.3         98444-98446
FEATURES             Location/Qualifiers
     source          1..2029
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="13"
                     /map="13"
     gene            1..2029
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /note="muscle segment homeobox 3"
                     /db_xref="GeneID:30526"
                     /db_xref="ZFIN:ZDB-GENE-980526-306"
     exon            1..517
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /inference="alignment:Splign:2.1.0"
     CDS             112..933
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /note="etID309953.13; muscle segment homeobox C"
                     /codon_start=1
                     /product="homeobox protein MSH-C"
                     /protein_id="NP_571347.2"
                     /db_xref="GeneID:30526"
                     /db_xref="ZFIN:ZDB-GENE-980526-306"
                     /translation="
MAPLSSMMNSEGPLSQEGKLQERKSADKEDAQSNDKAAVKGCKGKALSLPFSVESLISDRTSSRTLYTSSEAGIISPTSGADERLKLSPMALYADRKIPVESVSNLSDCKRGDMEELSDKGQSGWFQTTSYTSPPRHSSPPPCTLRKHKNNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSNSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKLATKPLLPAFAFPFPLGTHVGSPPLYGPSSSFPRPALPVPGLFGGPVTYGMYYLS"
     misc_feature    order(565..579,583..585,634..636,652..654,691..693,
                     697..702,709..714,718..726,730..735)
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    571..732
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(571..573,580..582,700..702,709..714,721..723)
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            518..2029
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /inference="alignment:Splign:2.1.0"
     STS             554..663
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /standard_name="mshc"
                     /db_xref="UniSTS:186992"
     STS             967..1201
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /standard_name="fc66g03.y1"
                     /db_xref="UniSTS:194220"
     STS             1293..1754
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /standard_name="msxc"
                     /db_xref="UniSTS:186994"
     STS             1681..1831
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /standard_name="fb80d12.x1"
                     /db_xref="UniSTS:191555"
     STS             1725..1829
                     /gene="msx3"
                     /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc;
                     zgc:86596"
                     /standard_name="fb80d12.x1"
                     /db_xref="UniSTS:191554"
ORIGIN      
gcgagtgcgctctgcttggagagcgaggcaagcgtcgcaaaagcgcgacggcagaagggaagcgctgctggaccagagtacagttcaggacgactcacatattcttgttgtatggcccctttatcatctatgatgaattctgaagggccactctcccaagaaggaaaactacaggagcgcaaaagcgcggacaaagaggatgctcaatccaacgataaagcggctgtcaaaggatgtaaaggcaaagcgctgagtctcccgttcagtgtggaatctttaatatcagacagaacaagctcacggactttatacacgtcttctgaagctggtattatatctccgacatccggtgcggatgagcggctgaagctctcgcccatggctctttacgcagataggaagatcccagtggagagcgtctccaacctctccgactgcaagagaggggatatggaagaactaagtgacaagggacagtccggctggtttcagacaacctcgtacacttctccgccaaggcattcaagtccacccccctgtaccctcagaaagcacaagaacaaccgaaaaccgcggaccccgtttaccacctcgcagttgctcgctttggagagaaaatttcgtcaaaaacagtatctttctattgcagagagagcggaattttccaattcactcaacctcacagagactcaagttaaaatctggtttcaaaacagacgggcgaaggcaaaaagactccaggaggccgaactagagaaactgaaacttgcaaccaagccgttattacctgcgttcgcctttccgttcccactcggaacacatgttggttctccaccactctacggaccgtccagctcctttcccagacctgccttaccagtcccgggacttttcggtgggccagtgacctacggaatgtattatttgtcttaacagactgaagcacgtccttcaattcaccgtctgtaactgctgcaattctgccagtcaaaagacgtgtgaaattgcaaatatgtttcctttatagaacttaagcaaatgcaaaaatttaaaataaattatttttgtaatccacacggtttattccaaaagtaatagtacccaaattggttttaaaagtgcaatgaatattccccttaatacagaagactttatgctgtattatacaagtatagcctacagacacaccgctatgtgaataattgtcttagtctcagagaaaatatttccagtagattatttcaagggcacagccgatctagaaagtttctagagcagcatcatttgttgatgtgtgatgcgaaaataaactcctggtttgtgccagttccaaaaagctcttaaagaagaccttataattactatttttttttaaattaaagtgcttgtttcgactggcagcagaataggcctataccgtaaaaataaaagttttactgtgtcattgctactttccataggtctgccctaattggggcctaaatggattgtaagagccttttttaaattaatccatgtattttcactcaaaccaaatattttgtagaatattacaaagattgtgctcagatatcaaaattagcaaattctctactgccaatctggttacttgtttttatttctgcccgctattagtttcagatattcgatttgttatttggttggtctttattgaatatgatcaacgagaaacagcatcttcaattactctatactttttcttcccaaaccttttgggacacagagtattttggcctgtgttttttgattttcgcctgtttagccataatcccttcagtagactacatgtatgctagtttgctaggttgtaagaataatgtctagatttttttattattgtaaatacacgtatatattacagattttgcattccctttgaacaaaaatacaaacagaattgctgatatttatacactgtttacatttatcttctgtaaattattgtatattttatatgtatatacaaattagaaataatcttttgcattaaaataaatcttcacagaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]