2024-05-06 22:17:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_126068 941 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana homeobox 53 (HB53), mRNA. ACCESSION NM_126068 VERSION NM_126068.3 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 941) AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E., Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M., Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R., Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J., Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J., Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L., Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B., Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E., Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A., Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M., See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L., Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R., Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R., Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N., Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B., Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H., Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W., Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M., Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S., Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K., Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C., Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P. CONSRTM Kazusa DNA Research Institute; Cold Spring Harbor and Washington University in St Louis Sequencing Consortium; European Union Arabidopsis Genome Sequencing Consortium TITLE Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 823-826 (2000) PUBMED 11130714 REFERENCE 2 (bases 1 to 941) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 941) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 941) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003076). On Sep 12, 2016 this sequence version replaced NM_126068.2. FEATURES Location/Qualifiers source 1..941 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="5" /ecotype="Columbia" gene 1..941 /gene="HB53" /locus_tag="AT5G66700" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /note="Encodes a homeodomain protein. Member of HD-ZIP 1 family, most closely related to HB5. AtHB53 is auxin-inducible and its induction is inhibited by cytokinin, especially in roots therefore may be involved in root development." /db_xref="Araport:AT5G66700" /db_xref="GeneID:836803" /db_xref="TAIR:AT5G66700" CDS 132..818 /gene="HB53" /locus_tag="AT5G66700" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Helix-turn-helix motif, lambda-like repressor (InterPro:IPR000047), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: homeobox protein 40 (TAIR:AT4G36740.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)." /codon_start=1 /product="homeobox 53" /protein_id="NP_201471.1" /db_xref="GeneID:836803" /db_xref="TAIR:AT5G66700" /db_xref="Araport:AT5G66700" /translation="
MDHGRLMDDQMMLGSQVYPYTTQPQNSHCIIVNQIDGGEESKPVKRRRKRRSKGSSATNEEDVAEIGGMLRKRKLTDEQVNMLEYSFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNKKLEEEYAKLKNHHDNVVLGQCQLESQILKLTEQLSEAQSEIRKLSERLEEMPTNSSSSSLSVEANNAPTDFELAPETNYNIPFYMLDNNYLQSMEYWDGLYV"
misc_feature order(342..350,354..356,405..407,423..425,462..464, 468..473,480..485,489..497,501..506) /gene="HB53" /locus_tag="AT5G66700" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(342..344,351..353,471..473,480..485,492..494) /gene="HB53" /locus_tag="AT5G66700" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 354..503 /gene="HB53" /locus_tag="AT5G66700" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" ORIGIN
cacagtcgttgaggttataaaaagcatctcataggactcaacctcaccaaagtcatatcctattgcatcactctcctttaaacacagtcagagaaaacagcaactcttgtctgaaaaactagagagagaaaatggatcatggtaggttaatggatgatcaaatgatgctaggctctcaagtgtacccctacacgacccaaccccaaaattcacactgcatcatcgttaaccagatcgatggaggcgaagaatcaaaaccggtgaagcggaggaggaagaggaggagtaaaggttcatcagccaccaacgaagaagacgtggcggagatcggagggatgttgaggaagaggaagttgaccgatgaacaagtgaacatgctcgaatatagcttcgggaacgagcataagctggagtcagggaggaaggagaagatcgccggagagttaggtcttgacccgagacaggtggctgtttggttccagaaccgccgtgcacgttggaagaacaagaaactagaggaagagtacgccaaactcaaaaaccaccacgacaacgtcgtactcggccaatgccaactcgagtctcagatattgaaactaacagaacaattgagtgaagctcaaagtgaaattcgaaaactgtcggaacgacttgaagaaatgccaaccaacagttcaagttcatcgctttctgttgaagccaacaatgcaccaactgatttcgagcttgccccggaaactaattataacatcccgttttatatgttagataataattatttacaaagcatggagtattgggatggtttgtatgtataatcagtttatcaactaaatatctcgtgctttattgatgcaactcatgttattataagtaatgtagaaataggtgttggtgaaacggttgtaattatgtgttgttttcagtatttattttaatat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]