GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-23 03:48:30, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       NM_115903               1447 bp    mRNA    linear   PLN 20-MAR-2017
DEFINITION  Arabidopsis thaliana homeobox-leucine zipper protein 3 (HAT3),
            mRNA.
ACCESSION   NM_115903
VERSION     NM_115903.3
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1447)
  AUTHORS   Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M.,
            Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B.,
            Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De
            Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P.,
            Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F.,
            Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V.,
            Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S.,
            Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P.,
            Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S.,
            Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H.,
            Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M.,
            Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A.,
            Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C.,
            Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P.,
            Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M.,
            Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S.,
            Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L.,
            Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A.,
            Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B.,
            Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J.,
            Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X.,
            Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M.,
            Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S.,
            Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A.,
            Yamada,M., Yasuda,M. and Tabata,S.
  CONSRTM   European Union Chromosome 3 Arabidopsis Sequencing Consortium;
            Institute for Genomic Research; Kazusa DNA Research Institute
  TITLE     Sequence and analysis of chromosome 3 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 820-822 (2000)
   PUBMED   11130713
REFERENCE   2  (bases 1 to 1447)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAR-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1447)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1447)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003074).
            On Sep 12, 2016 this sequence version replaced NM_115903.2.
FEATURES             Location/Qualifiers
     source          1..1447
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="3"
                     /ecotype="Columbia"
     gene            1..1447
                     /gene="HAT3"
                     /locus_tag="AT3G60390"
                     /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper
                     protein 3"
                     /note="Encodes homeobox protein HAT3."
                     /db_xref="Araport:AT3G60390"
                     /db_xref="GeneID:825210"
                     /db_xref="TAIR:AT3G60390"
     CDS             292..1239
                     /gene="HAT3"
                     /locus_tag="AT3G60390"
                     /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper
                     protein 3"
                     /inference="Similar to RNA sequence,
                     EST:INSD:EL008071.1,INSD:BP625109.1,INSD:EL244669.1,
                     INSD:BP588383.1,INSD:EL094773.1,INSD:EH994064.1,
                     INSD:DR366080.1,INSD:EL307655.1,INSD:AV806111.1,
                     INSD:EH944299.1,INSD:EH917806.1,INSD:N65201.1,
                     INSD:DR366081.1,INSD:EL288108.1,INSD:AI994165.1,
                     INSD:DR751566.1,INSD:EL278661.1,INSD:DR366082.1,
                     INSD:BP630449.1,INSD:AV810139.1,INSD:ES003185.1,
                     INSD:DR366083.1,INSD:DR366085.1,INSD:AI994164.1,
                     INSD:EL111928.1,INSD:DR366084.1,INSD:DR383804.1,
                     INSD:EH971727.1,INSD:EL129507.1,INSD:DR751567.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BT008713.1,INSD:AJ440781.1,INSD:U09338.1,
                     INSD:BX822559.1,INSD:AY099565.1"
                     /note="homeobox-leucine zipper protein 3 (HAT3); FUNCTIONS
                     IN: sequence-specific DNA binding transcription factor
                     activity; INVOLVED IN: regulation of transcription,
                     DNA-dependent, transcription, regulation of transcription;
                     LOCATED IN: nucleus; EXPRESSED IN: 20 plant structures;
                     EXPRESSED DURING: 12 growth stages; CONTAINS InterPro
                     DOMAIN/s: HD-ZIP protein, N-terminal (InterPro:IPR006712),
                     Homeobox, conserved site (InterPro:IPR017970), Homeobox
                     (InterPro:IPR001356), Homeodomain-like
                     (InterPro:IPR009057), Leucine zipper, homeobox-associated
                     (InterPro:IPR003106), Homeodomain-related
                     (InterPro:IPR012287); BEST Arabidopsis thaliana protein
                     match is: homeobox-leucine zipper protein 4
                     (TAIR:AT2G44910.1); Has 9598 Blast hits to 9528 proteins
                     in 546 species: Archae - 0; Bacteria - 0; Metazoa - 7082;
                     Fungi - 271; Plants - 2066; Viruses - 4; Other Eukaryotes
                     - 175 (source: NCBI BLink)."
                     /codon_start=1
                     /product="homeobox-leucine zipper protein 3"
                     /protein_id="NP_191598.1"
                     /db_xref="GeneID:825210"
                     /db_xref="TAIR:AT3G60390"
                     /db_xref="Araport:AT3G60390"
                     /translation="
MSERDDGLGLSLSLSLGFNQKDPSSRLNPMPLASYASSSHMQHMQQSNYNHPQKIQNTWINMFQSSERNSDMRSFLRGIDVNRAPSTVVVDVEDEGAGVSSPNSTVSSVMSGKKSERELMAAAGAVGGGRVEDNEIERASCSLGGGSDDEDGSGNGDDSSRKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRLQKEVSELRALKLSPHLYMHMKPPTTLTMCPSCERVAVTSSSSSVAPPVMNSSSPMGPMSPWAAMPLRQRPAAGSH"
     misc_feature    343..645
                     /gene="HAT3"
                     /locus_tag="AT3G60390"
                     /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper
                     protein 3"
                     /note="HD-ZIP protein N terminus; Region: HD-ZIP_N;
                     pfam04618"
                     /db_xref="CDD:282474"
     misc_feature    order(772..783,787..789,838..840,856..858,895..897,
                     901..906,913..918,922..930,934..939)
                     /gene="HAT3"
                     /locus_tag="AT3G60390"
                     /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper
                     protein 3"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(775..777,784..786,904..906,913..918,925..927)
                     /gene="HAT3"
                     /locus_tag="AT3G60390"
                     /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper
                     protein 3"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    784..936
                     /gene="HAT3"
                     /locus_tag="AT3G60390"
                     /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper
                     protein 3"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    940..1071
                     /gene="HAT3"
                     /locus_tag="AT3G60390"
                     /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper
                     protein 3"
                     /note="homeobox associated leucin zipper; Region: HALZ;
                     smart00340"
                     /db_xref="CDD:128634"
ORIGIN      
tttatgcagtatatatcatcattgaggtaacagaggtctctctgacacaagtcatcattgaaaccctaagcctccccacaaccccatatctctttgtctgaaaaaactcttttgcatatataaataaatataagccatatcttttgaaactgtactgctgcacaagtgtagaggcagtggcacaacatctttaagaaagagagagagaaagagtcatttattcatttcctcgcttaaaaatcttgagcacccagacagaattcttctttcttctttctggggttgagaaaaatgagtgaaagagatgatggattggggctaagtttgagcttgagtttaggttttaatcaaaaggacccgtcttcgaggttaaatccaatgcctctggcttcttatgcatcttcatcacacatgcagcatatgcagcagagcaattataaccatcctcaaaagattcagaacacttggattaacatgtttcagtcatcagagagaaactcggacatgagatcgtttctccggggaatagacgtgaacagagctccatcgacggtggtggttgacgtggaggatgaaggcgccggagtttcgtctccgaacagcaccgtctcaagcgtgatgagcgggaagaagagcgagcgagagctaatggctgcggcaggtgcagttggaggaggtagagtagaagataatgagattgagagagcttcttgctcgctcggcggtggtagcgacgatgaagacggtagcgggaacggagatgacagttcgaggaagaaactccgattgtctaaagaacaagctttggttcttgaagaaacttttaaagaacatagtacactcaatccgaagcaaaagatggctttggctaagcaattgaatctgaggacgagacaagttgaagtgtggttccaaaaccgaagggcaaggacgaagctgaagcaaacggaagtagactgtgaatatcttaagagatgttgcgagaatctaacggatgagaatcggagattgcaaaaggaagtgagtgagcttagggctttaaagctttctccacacttatacatgcacatgaaacctcccactactctcacaatgtgtccttcttgcgagcgagtcgctgttacgtcatcttcgtcatcggtggctcctcctgtgatgaattcatcgtctccgatgggtccgatgagtccgtgggctgccatgcctctacggcaacgacctgctgctggttctcattagagtttaattagtctaaagataataggtttggtgatttgtttttattatattgttgaacggacttggaagttcttttcaagagttggtcccatgctcttctttcctttgttttattcagtttctatttatagctgaattctggataatggaaaatctactaatattattgtccaattattagtttggggaaagataagaggttctatca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]