GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2017-09-24 13:53:54, GGRNA : RefSeq release 83 (Jul, 2017)



Matches are highlighted with green background. Overlapping matches are dark colored.

Gallus gallus paired related homeobox 1 (PRRX1), transcript variant 1, mRNA. (1879 bp)
oduct; homeobox protein MHOX; paired-related homeobox protein 1; transcription factor Prx1b" /codon_start=1 /product="paired mesoderm homeobox protein 1" /protein_id="NP_001264653.1" /db_xref="CGNC:48968" /db_xref="GeneID:373941" /translation="MASSYAHAMERQALLPARLDGPAGLDNLQAKKNFSVSHLLDLEEAGDMVAAQGDEGGGEPGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLASKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSTTCTNASPAQGMNMANSIANLRLKAKEYSLQRNQVPTVN" misc_feature 530..685 /gene="PRRX1" /gene_synonym="gMHox; homeobox; PMX1; Prx-1; Prx1" /note="Homeobox domain...
Synonym: gMHox; homeobox; PMX1; Prx-1; Prx1
NM_001277724.1 - Gallus gallus (chicken) - NCBI - UCSC
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1;...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Zea mays homeobox 3 (hox3), mRNA. (5334 bp)
LOCUS NM_001309211 5334 bp mRNA linear PLN 10-JUN-2017 DEFINITION Zea mays homeobox 3 (hox3), mRNA. ACCESSION NM_001309211 XM_008675214 VERSION NM_001309211.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from LPUQ01001404.1. On May 21, 2015 this sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a
NM_001309211.1 - Zea mays - NCBI
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
LOCUS NM_205533 1018 bp mRNA linear VRT 10-JUN-2017 DEFINITION Gallus gallus H6 family homeobox 1 (HMX1), mRNA. ACCESSION NM_205533 VERSION NM_205533.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AADN04000085.1. On...
Synonym: GH6
NM_205533.2 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
mol_type="mRNA" /strain="mixed" /db_xref="taxon:10116" /chromosome="4" /map="4q24" gene 1..1518 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Rattus norvegicus homeo box B8 (Hoxb8), mRNA. (973 bp)
specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 448..606 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 19..159 /gene="Hoxb8" /gene_synonym="Hox2r1a" /standard_name="Hoxb8" /db_xref="UniSTS:536655" ORIGIN // REFERENCE 1 (bases 1 to 973) AUTHORS Iimura T, Oida S, Takeda K, Maruoka Y and Sasaki S. TITLE Changes in homeobox-containing gene expression during ectopic bone formation induced by bone morphogenetic protein JOURNAL Biochem. Biophys. Res. Commun. 201 (2), 980-987 (1994)...
Synonym: Hox2r1a
NM_001191649.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Fundulus heteroclitus homeobox protein Hox-A2b-like (LOC105926292), mRNA. (1318 bp)
##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1318 /organism="Fundulus heteroclitus" /mol_type="mRNA" /db_xref="taxon:8078" gene 1..1318 /gene="LOC105926292" /gene_synonym="Hoxa2x" /note="homeobox protein Hox-A2b-like" /db_xref="GeneID:105926292" CDS 121..1110 /gene="LOC105926292" /gene_synonym="Hoxa2x" /note="homeobox A2x; Hox A2b; Homeobox protein Hox-A2; homeobox A2b" /codon_start=1 /product="homeobox protein Hox-A2b-like" /protein_id="NP_001296907.1" /db_xref="GeneID:105926292" /translation="...
Synonym: Hoxa2x
NM_001309978.1 - Fundulus heteroclitus (mummichog) - NCBI
Rattus norvegicus reproductive homeobox 7 (Rhox7), mRNA. (900 bp)
reproductive homeobox 7" /protein_id="NP_001020825.1" /db_xref="GeneID:298353" /db_xref="RGD:1563189" /translation="MWFSNRRAKERACEKKAMPRSIPGAKAQMILPAGEGRNGEESERSSPGQEASATKWGEVEELGERDRTGSDGENLSAVGTSGIRNDWDKEGASSSRQKNESRPQKPVPECRWGMEDVQPVPVLIPRVQRIQLVQSRVQSVPLKVPTPRIRPVAVSATTVQPEPVLVPRRHLHDRFTDPELQELERERVFQRNHYLSAEERKELARVMGVSEAKVQRWFKKRREHFRREQSQSGGAPPGNTPPLSEDGAGALVYHP" misc_feature order(520..522,646..648,655..660,667..669) /gene="Rhox7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..666 /gene="Rhox7" /note="Homeobox domain; Region...
NM_001025654.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox A5 (HOXA5), mRNA. (1191 bp)
gene_synonym="HOX1.3; HOX1C" /note="Region: homeobox" misc_feature order(628..642,646..648,697..699,715..717,754..756, 760..765,772..777,781..789,793..798) /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(634..636,643..645,763..765,772..777,784..786) /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 637..795 /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD...
Synonym: HOX1.3; HOX1C
NM_001318419.1 - Gallus gallus (chicken) - NCBI - UCSC
Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. (1821 bp)
LOCUS NM_001165009 1821 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. ACCESSION NM_001165009 VERSION NM_001165009.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="drgx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..692 /gene="drgx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001165009.1 - Saccoglossus kowalevskii - NCBI
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 8..75 /gene="HOXA6" /standard_name="Hoxa6" /db_xref="UniSTS:536644" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Oncorhynchus mykiss hematopoietically expressed homeobox (hhex), mRNA. (1172 bp)
SAMD00041049 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1172 /organism="Oncorhynchus mykiss" /mol_type="mRNA" /db_xref="taxon:8022" gene 1..1172 /gene="hhex" /note="hematopoietically expressed homeobox" /db_xref="GeneID:100305190" misc_feature 95..97 /gene="hhex" /note="upstream in-frame stop codon" CDS 116..964 /gene="hhex" /note="Homeobox protein PRH" /codon_start=1 /product="hematopoietically-expressed homeobox protein hhex" /protein_id="NP_001158566.1" /db_xref="GeneID:100305190" /translation="...
NM_001165094.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Oncorhynchus mykiss caudal-type homeobox protein 1 (cdx1), mRNA. (1497 bp)
cdx1" /inference="non-experimental evidence, no additional details recorded" /note="Region: homeobox" misc_feature order(545..556,560..562,611..613,629..631,668..670, 674..679,686..691,695..703,707..712) /gene="cdx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(548..550,557..559,677..679,686..691,698..700) /gene="cdx1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 551..709 /gene="cdx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 563..607 /gene="cdx1" /...
NM_001124632.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Gallus gallus homeobox A6 (HOXA6), mRNA. (1467 bp)
LOCUS NM_001030987 1467 bp mRNA linear VRT 14-JUN-2017 DEFINITION Gallus gallus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001030987 XM_418729 VERSION NM_001030987.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 469..627 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1467) AUTHORS Attia L, Yelin R and Schultheiss TM....
Synonym: HOX1; HOX1.2; HOX1B
NM_001030987.2 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus Mix paired-like homeobox 1 (Mixl1), mRNA. (2342 bp)
product="homeobox protein MIXL1" /protein_id="NP_001099449.1" /db_xref="GeneID:289311" /db_xref="RGD:1310011" /translation="MAAAGSQQLQFAEGAAFPTFPAAHPGGQLLPAARPATGLPPAPPDSRAPAATPCFPSRGPRPAAQTPTGLDPPGPSKGSAAPSAPQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLSSRREDFLHRPAPGTEARCLKPQLPLEADVNHVLDSSMAGGGVCTSGSQGFETYSSLSEDIGSKLDSWEEHIFSALGSF" misc_feature order(281..295,299..301,350..352,368..370,407..409, 413..418,425..430,434..442,446..451) /gene="Mixl1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 287..448 /gene="Mixl1" /note="Homeobox domain...
NM_001105979.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. (2158 bp)
LOCUS NM_001164939 2158 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. ACCESSION NM_001164939 VERSION NM_001164939.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 487..645 /gene="hox6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2158) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164939.1 - Saccoglossus kowalevskii - NCBI
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Gallus gallus homeobox D11 (HOXD11), mRNA. (1006 bp)
LOCUS NM_204620 1006 bp mRNA linear VRT 25-JUN-2017 DEFINITION Gallus gallus homeobox D11 (HOXD11), mRNA. ACCESSION NM_204620 XM_001234561 VERSION NM_204620.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...GHOX4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 709..870 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(709..711,718..720,838..840,847..852,859..861) /gene="HOXD11" /gene_...
Synonym: GHOX4.6
NM_204620.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D8 (HOXD8), mRNA. (1263 bp)
LOCUS NM_207177 1263 bp mRNA linear VRT 25-JUN-2017 DEFINITION Gallus gallus homeobox D8 (HOXD8), mRNA. ACCESSION NM_207177 VERSION NM_207177.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...HOXD8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 460..618 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" variation complement(329) /gene="HOXD8" /replace="g" /replace="t" /db_xref="dbSNP...
NM_207177.1 - Gallus gallus (chicken) - NCBI - UCSC
Pan troglodytes msh homeobox 1 (MSX1), mRNA. (1932 bp)
NM_001195262.2 - Pan troglodytes (chimpanzee) - NCBI
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 KEYWORDS RefSeq. SOURCE Takifugu rubripes (Fugu rubripes) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata; Craniata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (Fugu rubripes) - NCBI
Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. (1822 bp)
LOCUS NM_001164980 1822 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. ACCESSION NM_001164980 VERSION NM_001164980.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 355..474 /gene="tgif1" /gene_synonym="tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 1822) AUTHORS Freeman,R.M. Jr., Wu,M., Cordonnier-...
Synonym: tgif
NM_001164980.1 - Saccoglossus kowalevskii - NCBI
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_053630) mRNA, complete cds. (747 bp)
locus_tag="EIN_053630" /note="encoded by transcript EIN_053630A" /codon_start=1 /product="homeobox protein knotted-1, putative" /protein_id="XP_004259889.1" /db_xref="GeneID:14892326" /translation="MEPTQEVQKVLTECVNKTIDFDQYLKCFEQSLVRPSGDISDQSLMEKVQHVADLVTGEKLLRLNELVQIFNSQAEVLYLYYTSYYTQLVSLLDSQSQKRIVTQDERSYKISCLRALFGNIYSHLKLMFGSNVSSLAPRERKIPTFLSPQISVHSITSQSQPLSKITCKNSLVLSSTKPTKPIFKIDKIKTQSPKTQKIKPLLDWFVLHSNHPYPTEEQKERLGSECGMSPKQVGTWFSNKRNRNKNQN" misc_feature 610..711 /locus_tag="EIN_053630" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1...
XM_004259841.1 - Entamoeba invadens IP1 - NCBI
Zea mays HOX1B protein (Hox1b), mRNA. (2974 bp)
c 1346-2098 EB403344.1 1-753 2099-2974 LPUQ01002925.1 503323-504198 c FEATURES Location/Qualifiers source 1..2974 /organism="Zea mays" /mol_type="mRNA" /cultivar="B73" /db_xref="taxon:4577" /chromosome="6" /map="6" gene 1..2974 /gene="Hox1b" /gene_synonym="GRMZM2G094935; homeobox2" /note="HOX1B protein" /db_xref="GeneID:732843" misc_feature 242..244 /gene="Hox1b" /gene_synonym="GRMZM2G094935; homeobox2" /note="upstream in-frame stop codon" CDS 254..2332 /gene="Hox1b" /gene_synonym="GRMZM2G094935; homeobox2" /note="putative homeodomain-like transcription factor superfamily protein" /codon_start...
Synonym: GRMZM2G094935; homeobox2
NM_001112448.2 - Zea mays - NCBI
Bombyx mori special homeobox protein 1 (shx1), mRNA. (885 bp)
feature 343..501 /gene="shx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 885) AUTHORS Ou J, Deng HM, Zheng SC, Huang LH, Feng QL and Liu L. TITLE Transcriptomic analysis of developmental features of Bombyx mori wing disc during metamorphosis JOURNAL BMC Genomics 15, 820 (2014) PUBMED 25261999 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 885) AUTHORS Chai CL, Zhang Z, Huang FF, Wang XY, Yu QY, Liu BB, Tian T, Xia QY, Lu C and Xiang ZH. TITLE A genomewide survey of homeobox genes and identification of novel...
NM_001146065.1 - Bombyx mori (domestic silkworm) - NCBI
Rattus norvegicus homeo box D3 (Hoxd3), mRNA. (2527 bp)
D3" /db_xref="GeneID:288152" /db_xref="RGD:1588601" STS 349..1945 /gene="Hoxd3" /gene_synonym="Hox4r6" /db_xref="UniSTS:491330" misc_feature 376..378 /gene="Hoxd3" /gene_synonym="Hox4r6" /note="upstream in-frame stop codon" CDS 382..1680 /gene="Hoxd3" /gene_synonym="Hox4r6" /note="homeobox protein R6; Homeobox gene D3" /codon_start=1 /product="homeobox protein Hox-D3" /protein_id="NP_001257967.1" /db_xref="GeneID:288152" /db_xref="RGD:1588601" /translation="...
Synonym: Hox4r6
NM_001271038.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Oncorhynchus mykiss NK2 homeobox 1b (nkx2.1b), mRNA. (2127 bp)
LOCUS NM_001124224 2127 bp mRNA linear VRT 03-JUL-2017 DEFINITION Oncorhynchus mykiss NK2 homeobox 1b (nkx2.1b), mRNA. ACCESSION NM_001124224 VERSION NM_001124224.1 KEYWORDS RefSeq. SOURCE Oncorhynchus mykiss (rainbow trout) ORGANISM Oncorhynchus mykiss Eukaryota; Metazoa; Chordata; Craniata;...gene="nkx2.1b" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 596..757 /gene="nkx2.1b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(596..598,605..607,725..727,734..739,746..748) /gene="nkx2.1b" /note="specific DNA...
NM_001124224.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (95 bp)
GeneID:8039835" /db_xref="VectorBase:ISCW012461" CDS 95 /locus_tag="IscW_ISCW012461" /note="encoded by transcript IscW_ISCW012461-RA" /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002413770.1" /db_xref="VectorBase:ISCW012461-PA" /db_xref="GeneID:8039835" /db_xref="VectorBase:ISCW012461" /translation="VDKYLSVSKRMELSATLNLTEVQIKTWFQNRR" misc_feature <4..95 /locus_tag="IscW_ISCW012461" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 95) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project TITLE Direct...
XM_002413725.1 - Ixodes scapularis (black-legged tick) - NCBI
Xenopus tropicalis TGFB induced factor homeobox 1 (tgif1), mRNA. (2042 bp)
LOCUS NM_204051 2042 bp mRNA linear VRT 03-JUN-2017 DEFINITION Xenopus tropicalis TGFB induced factor homeobox 1 (tgif1), mRNA. ACCESSION NM_204051 VERSION NM_204051.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 456..575 /gene="tgif1" /gene_synonym="hpe4; tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 2042) AUTHORS Klein SL, Strausberg RL, Wagner L...
Synonym: hpe4; tgif
NM_204051.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. (2551 bp)
LOCUS NM_001164940 2551 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. ACCESSION NM_001164940 VERSION NM_001164940.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox9/10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1170..1331 /gene="hox9/10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1170..1172,1179..1181,1299..1301,1308..1313, 1320..1322) /gene="hox9/10" /note="...
NM_001164940.1 - Saccoglossus kowalevskii - NCBI
Saccoglossus kowalevskii homeobox 2 (hox2), mRNA. (3042 bp)
LOCUS NM_001164937 3042 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 2 (hox2), mRNA. ACCESSION NM_001164937 VERSION NM_001164937.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 976..1134 /gene="hox2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 3042) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164937.1 - Saccoglossus kowalevskii - NCBI
Danio rerio posterior neuron-specific homeobox (pnx), mRNA. (867 bp)
gene="pnx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 280..438 /gene="pnx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 867) AUTHORS Wotton,K.R., Weierud,F.K., Juarez-Morales,J.L., Alvares,L.E., Dietrich,S. and Lewis,K.E. TITLE Conservation of gene linkage in dispersed vertebrate NK homeobox clusters JOURNAL Dev. Genes Evol. 219 (9-10), 481-496 (2009) PUBMED 20112453 REFERENCE 2 (bases 1 to 867) AUTHORS Bae,Y.K., Shimizu,T. and Hibi,M. TITLE Patterning of proneuronal and...
NM_178302.2 - Danio rerio (zebrafish) - NCBI - UCSC
Rattus norvegicus homeo box C4 (Hoxc4), mRNA. (2068 bp)
box C4" /db_xref="GeneID:24459" /db_xref="RGD:1586210" STS 151..1416 /gene="Hoxc4" /gene_synonym="Hox3r3" /db_xref="UniSTS:491379" misc_feature 356..358 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="upstream in-frame stop codon" CDS 428..1222 /gene="Hoxc4" /gene_synonym="Hox3r3" /note="homeobox protein R3; Homeobox gene C4" /codon_start=1 /product="homeobox protein Hox-C4" /protein_id="NP_001103354.1" /db_xref="GeneID:24459" /db_xref="RGD:1586210" /translation="...
Synonym: Hox3r3
NM_001109884.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Ixodes scapularis homeobox protein, putative, mRNA. (201 bp)
db_xref="VectorBase:ISCW020382" CDS 1..201 /locus_tag="IscW_ISCW020382" /note="encoded by transcript IscW_ISCW020382-RA" /codon_start=1 /product="homeobox protein, putative" /protein_id="XP_002402536.1" /db_xref="VectorBase:ISCW020382-PA" /db_xref="GeneID:8033067" /db_xref="VectorBase:ISCW020382" /translation="MGRYFSTFQKEQLTKAFVCNAYPDTAQQRTLAFRLGLTTEQVKVWFANKRTRDRKRAVLFPELRLF" misc_feature 13..162 /locus_tag="IscW_ISCW020382" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 201) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project...
XM_002402492.1 - Ixodes scapularis (black-legged tick) - NCBI
Ixodes scapularis homeobox protein mox, putative, mRNA. (180 bp)
db_xref="VectorBase:ISCW024860" CDS 180 /locus_tag="IscW_ISCW024860" /note="encoded by transcript IscW_ISCW024860-RA" /codon_start=1 /product="homeobox protein mox, putative" /protein_id="XP_002415595.1" /db_xref="VectorBase:ISCW024860-PA" /db_xref="GeneID:8042510" /db_xref="VectorBase:ISCW024860" /translation="PRKERTAFSKHQVQELESEFAQRNYLTRLRRYEIALALDLTERQVRALYELSTSCARKDA" misc_feature 13..>138 /locus_tag="IscW_ISCW024860" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 180) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project...
XM_002415550.1 - Ixodes scapularis (black-legged tick) - NCBI
Gallus gallus BARX homeobox 1 (BARX1), mRNA. (1170 bp)
LOCUS NM_204193 1170 bp mRNA linear VRT 02-JUL-2017 DEFINITION Gallus gallus BARX homeobox 1 (BARX1), mRNA. ACCESSION NM_204193 VERSION NM_204193.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...BARX1B" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 465..626 /gene="BARX1" /gene_synonym="BARX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(465..467,474..476,594..596,603..608,615..617) /gene="BARX1" /gene_...
Synonym: BARX1B
NM_204193.1 - Gallus gallus (chicken) - NCBI - UCSC
Ixodes scapularis emx homeobox protein, putative, mRNA. (213 bp)
xref="VectorBase:ISCW012144" CDS 1..213 /locus_tag="IscW_ISCW012144" /note="encoded by transcript IscW_ISCW012144-RA" /codon_start=1 /product="emx homeobox protein, putative" /protein_id="XP_002414084.1" /db_xref="VectorBase:ISCW012144-PA" /db_xref="GeneID:8040230" /db_xref="VectorBase:ISCW012144" /translation="MPKEGPEPAGFLLHPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQVEDARLSF" misc_feature 67..>189 /locus_tag="IscW_ISCW012144" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 213) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome...
XM_002414039.1 - Ixodes scapularis (black-legged tick) - NCBI
Mesocricetus auratus LIM homeobox 1 (Lhx1), mRNA. (1302 bp)
SAMN01831925 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1302 /organism="Mesocricetus auratus" /mol_type="mRNA" /db_xref="taxon:10036" gene 1..1302 /gene="Lhx1" /gene_synonym="Lim-1; Lim1; lmx2" /note="LIM homeobox 1" /db_xref="GeneID:101828732" CDS 12..1232 /gene="Lhx1" /gene_synonym="Lim-1; Lim1; lmx2" /note="Homeobox protein LMX-2; Homeobox protein Lim-1; LIM homeobox protein 1" /codon_start=1 /product="LIM/homeobox protein Lhx1" /protein_id="NP_001268538.1" /db_xref="GeneID:101828732" /translation="...
Synonym: Lim-1; Lim1; lmx2
NM_001281609.1 - Mesocricetus auratus (golden hamster) - NCBI
Salmo salar homeobox protein HoxB9ab (hoxb9ab), mRNA. (1216 bp)
LOCUS NM_001141626 1216 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxB9ab (hoxb9ab), mRNA. ACCESSION NM_001141626 VERSION NM_001141626.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxb9ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 651..812 /gene="hoxb9ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(651..653,660..662,780..782,789..794,801..803) /gene="hoxb9ab" /note="specific DNA...
NM_001141626.1 - Salmo salar (Atlantic salmon) - NCBI
Danio rerio mohawk homeobox b (mkxb), mRNA. (1224 bp)
LOCUS NM_001114409 1224 bp mRNA linear VRT 03-JUL-2017 DEFINITION Danio rerio mohawk homeobox b (mkxb), mRNA. ACCESSION NM_001114409 XM_678904 VERSION NM_001114409.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi...gene="mkxb" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 445..564 /gene="mkxb" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 1224) AUTHORS Hsu CH, Lin JS, Po Lai K, Li JW,...
NM_001114409.1 - Danio rerio (zebrafish) - NCBI - UCSC
Salmo salar homeobox protein HoxC11ab (hoxc11ab), mRNA. (1046 bp)
LOCUS NM_001141665 1046 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxC11ab (hoxc11ab), mRNA. ACCESSION NM_001141665 VERSION NM_001141665.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxc11ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 809..970 /gene="hoxc11ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(809..811,818..820,938..940,947..952,959..961) /gene="hoxc11ab" /note="specific DNA...
NM_001141665.1 - Salmo salar (Atlantic salmon) - NCBI
Bos taurus orthopedia homeobox (OTP), mRNA. (2686 bp)
NM_001103312.1 - Bos taurus (cattle) - NCBI
Xenopus laevis TGFB induced factor homeobox 1 S homeolog (tgif1.S), mRNA. (1827 bp)
LOCUS NM_001086951 1827 bp mRNA linear VRT 03-JUN-2017 DEFINITION Xenopus laevis TGFB induced factor homeobox 1 S homeolog (tgif1.S), mRNA. ACCESSION NM_001086951 VERSION NM_001086951.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 262..381 /gene="tgif1.S" /gene_synonym="tgif; tgif1" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 1827) AUTHORS Klein SL, Strausberg RL, Wagner L,...
Synonym: tgif; tgif1
NM_001086951.1 - Xenopus laevis (African clawed frog) - NCBI
Ixodes scapularis retinal homeobox protein, putative, mRNA. (384 bp)
locus_tag="IscW_ISCW014108" /note="encoded by transcript IscW_ISCW014108-RA" /codon_start=1 /product="retinal homeobox protein, putative" /protein_id="XP_002416102.1" /db_xref="VectorBase:ISCW014108-PA" /db_xref="GeneID:8043141" /db_xref="VectorBase:ISCW014108" /translation="MNDFRKHICTDFVERLAAESDLLRKIVTTGFELSSGPELSPGTGSRGSPGPEVAAPVTSECGQTPSANKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVRTFS" misc_feature 241..>369 /locus_tag="IscW_ISCW014108" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 384) AUTHORS Nene,V. CONSRTM Ixodes...
XM_002416057.1 - Ixodes scapularis (black-legged tick) - NCBI
Ixodes scapularis homeobox protein Pknox1, putative, mRNA. (912 bp)
XM_002411438.1 - Ixodes scapularis (black-legged tick) - NCBI
Malus domestica homeobox protein knotted-1-like 1 (KNAP1), mRNA. (1757 bp)
CDD:281745" misc_feature 1229..1294 /gene="KNAP1" /gene_synonym="HD10" /note="ELK domain; Region: ELK; pfam03789" /db_xref="CDD:281743" misc_feature 1349..1468 /gene="KNAP1" /gene_synonym="HD10" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 1757) AUTHORS Watillon B, Kettmann R, Boxus P and Burny A. TITLE Knotted1-like homeobox genes are expressed during apple tree (Malus domestica [L.] Borkh) growth and development JOURNAL Plant Mol. Biol. 33 (4), 757-763 (1997) PUBMED 9132068...
Synonym: HD10
NM_001311171.1 - Malus domestica (apple) - NCBI
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_475530) mRNA, complete cds. (858 bp)
LOCUS XM_004255584 858 bp mRNA linear INV 26-MAR-2013 DEFINITION Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_475530) mRNA, complete cds. ACCESSION XM_004255584 VERSION XM_004255584.1 KEYWORDS RefSeq. SOURCE Entamoeba invadens IP1 ORGANISM Entamoeba invadens IP1 Eukaryota;...containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature 709..828 /locus_tag="EIN_475530" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 858) AUTHORS Zafar,N., Inman,J., Hall,N., Lorenzi,H...
XM_004255584.1 - Entamoeba invadens IP1 - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (360 bp)
by transcript IscW_ISCW002094-RA; Gene spans sequencing gaps and may be missing exons." /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002408990.1" /db_xref="VectorBase:ISCW002094-PA" /db_xref="GeneID:8027604" /db_xref="VectorBase:ISCW002094" /translation="MFGKLWELETSATSPTSAATGTASTPGPGRGRLSVSPVNGASGDCADKAARKKKARTTFTGRQIFELEKQFEIKKYLSSSERAEMAKLLNVTETQGCRGITFGVVKLNTKNSANEGSPH" misc_feature 169..>285 /locus_tag="IscW_ISCW002094" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 360) AUTHORS Nene,V. CONSRTM Ixodes...
XM_002408946.1 - Ixodes scapularis (black-legged tick) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.135 | 0.135 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.223 | 0.088 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.228 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]