GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2017-03-23 09:12:31, GGRNA : RefSeq release 80 (Jan, 2017)



Matches are highlighted with green background. Overlapping matches are dark colored.

Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GI:281182387" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region:...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Rattus norvegicus reproductive homeobox 7 (Rhox7), mRNA. (900 bp)
ve homeobox 7" /protein_id="NP_001020825.1" /db_xref="GI:71043820" /db_xref="GeneID:298353" /db_xref="RGD:1563189" /translation="MWFSNRRAKERACEKKAMPRSIPGAKAQMILPAGEGRNGEESERSSPGQEASATKWGEVEELGERDRTGSDGENLSAVGTSGIRNDWDKEGASSSRQKNESRPQKPVPECRWGMEDVQPVPVLIPRVQRIQLVQSRVQSVPLKVPTPRIRPVAVSATTVQPEPVLVPRRHLHDRFTDPELQELERERVFQRNHYLSAEERKELARVMGVSEAKVQRWFKKRREHFRREQSQSGGAPPGNTPPLSEDGAGALVYHP" misc_feature order(520..522,646..648,655..660,667..669) /gene="Rhox7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..666 /gene="Rhox7" /note="Homeobox...
NM_001025654.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Oncorhynchus mykiss caudal-type homeobox protein 1 (cdx1), mRNA. (1497 bp)
cdx1" /inference="non-experimental evidence, no additional details recorded" /note="Region: homeobox" misc_feature order(545..556,560..562,611..613,629..631,668..670, 674..679,686..691,695..703,707..712) /gene="cdx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(548..550,557..559,677..679,686..691,698..700) /gene="cdx1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 551..709 /gene="cdx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 563..607 /gene="cdx1" /...
NM_001124632.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. (1821 bp)
LOCUS NM_001165009 1821 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. ACCESSION NM_001165009 VERSION NM_001165009.1 GI:259013475 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa;...gene="drgx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..692 /gene="drgx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001165009.1 - Saccoglossus kowalevskii - NCBI
Oncorhynchus mykiss hematopoietically expressed homeobox (hhex), mRNA. (1172 bp)
BT073862.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1172 /organism="Oncorhynchus mykiss" /mol_type="mRNA" /db_xref="taxon:8022" gene 1..1172 /gene="hhex" /note="hematopoietically expressed homeobox" /db_xref="GeneID:100305190" misc_feature 95..97 /gene="hhex" /note="upstream in-frame stop codon" CDS 116..964 /gene="hhex" /note="Homeobox protein PRH" /codon_start=1 /product="hematopoietically-expressed homeobox protein hhex" /protein_id="NP_001158566.1" /db_xref="GI:259089532" /db_xref="GeneID:100305190" /translation="...
NM_001165094.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 GI:284005066 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 8..75 /gene="HOXA6" /standard_name="Hoxa6" /db_xref="UniSTS:536644" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Sus scrofa mesenchyme homeobox 2 (MEOX2), mRNA. (915 bp)
LOCUS NM_214121 915 bp mRNA linear MAM 18-APR-2013 DEFINITION Sus scrofa mesenchyme homeobox 2 (MEOX2), mRNA. ACCESSION NM_214121 VERSION NM_214121.1 GI:47523049 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 571..729 /gene="MEOX2" /gene_synonym="GAX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 256..406 /gene="MEOX2" /gene_synonym="GAX" /standard_name="MEOX2" /db_xref="UniSTS:503608"...
Synonym: GAX
NM_214121.1 - Sus scrofa (pig) - NCBI
Sus scrofa distal-less homeobox 5 (DLX5), mRNA. (870 bp)
NM_001159660.1 - Sus scrofa (pig) - NCBI
Rattus norvegicus Mix paired-like homeobox 1 (Mixl1), mRNA. (2342 bp)
LOCUS NM_001105979 2342 bp mRNA linear ROD 26-AUG-2012 DEFINITION Rattus norvegicus Mix paired-like homeobox 1 (Mixl1), mRNA. ACCESSION NM_001105979 XM_001061956 XM_222997 VERSION NM_001105979.1 GI:157787023 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota...gene="Mixl1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 287..448 /gene="Mixl1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(287..289,296..298,416..418,425..430,437..439) /gene="Mixl1" /note="specific DNA base...
NM_001105979.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. (2158 bp)
LOCUS NM_001164939 2158 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. ACCESSION NM_001164939 VERSION NM_001164939.1 GI:259013407 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="hox6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 487..645 /gene="hox6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2158) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164939.1 - Saccoglossus kowalevskii - NCBI
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GI:213513788" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Ovis aries homeobox C6 (HOXC6), mRNA. (1196 bp)
LOCUS NM_001009335 1196 bp mRNA linear MAM 18-APR-2013 DEFINITION Ovis aries homeobox C6 (HOXC6), mRNA. ACCESSION NM_001009335 VERSION NM_001009335.1 GI:57164348 KEYWORDS RefSeq. SOURCE Ovis aries (sheep) ORGANISM Ovis aries Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia...HOXC6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 199..357 /gene="HOXC6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 58..267 /gene="HOXC6" /standard_name="MARC_44017-44022:1098368610:3" /db_xref="UniSTS...
NM_001009335.1 - Ovis aries (sheep) - NCBI
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 GI:74095942 KEYWORDS RefSeq. SOURCE Takifugu rubripes (Fugu rubripes) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (Fugu rubripes) - NCBI
Oncorhynchus mykiss NK2 homeobox 1b (nkx2.1b), mRNA. (2127 bp)
LOCUS NM_001124224 2127 bp mRNA linear VRT 17-APR-2013 DEFINITION Oncorhynchus mykiss NK2 homeobox 1b (nkx2.1b), mRNA. ACCESSION NM_001124224 VERSION NM_001124224.1 GI:185136008 KEYWORDS RefSeq. SOURCE Oncorhynchus mykiss (rainbow trout) ORGANISM Oncorhynchus mykiss Eukaryota; Metazoa; Chordata;...gene="nkx2.1b" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 596..757 /gene="nkx2.1b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(596..598,605..607,725..727,734..739,746..748) /gene="nkx2.1b" /note="specific DNA...
NM_001124224.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_053630) mRNA, complete cds. (747 bp)
note="encoded by transcript EIN_053630A" /codon_start=1 /product="homeobox protein knotted-1, putative" /protein_id="XP_004259889.1" /db_xref="GI:471206273" /db_xref="GeneID:14892326" /translation="MEPTQEVQKVLTECVNKTIDFDQYLKCFEQSLVRPSGDISDQSLMEKVQHVADLVTGEKLLRLNELVQIFNSQAEVLYLYYTSYYTQLVSLLDSQSQKRIVTQDERSYKISCLRALFGNIYSHLKLMFGSNVSSLAPRERKIPTFLSPQISVHSITSQSQPLSKITCKNSLVLSSTKPTKPIFKIDKIKTQSPKTQKIKPLLDWFVLHSNHPYPTEEQKERLGSECGMSPKQVGTWFSNKRNRNKNQN" misc_feature 610..711 /locus_tag="EIN_053630" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1...
XM_004259841.1 - Entamoeba invadens IP1 - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (95 bp)
db_xref="VectorBase:ISCW012461" CDS 95 /locus_tag="IscW_ISCW012461" /note="encoded by transcript IscW_ISCW012461-RA" /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002413770.1" /db_xref="GI:241727240" /db_xref="VectorBase:ISCW012461-PA" /db_xref="GeneID:8039835" /db_xref="VectorBase:ISCW012461" /translation="VDKYLSVSKRMELSATLNLTEVQIKTWFQNRR" misc_feature <4..95 /locus_tag="IscW_ISCW012461" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 95) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project TITLE Direct...
XM_002413725.1 - Ixodes scapularis (black-legged tick) - NCBI
Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. (1822 bp)
LOCUS NM_001164980 1822 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. ACCESSION NM_001164980 VERSION NM_001164980.1 GI:259013316 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 355..474 /gene="tgif1" /gene_synonym="tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 1822) AUTHORS Freeman,R.M. Jr., Wu,M., Cordonnier-...
Synonym: tgif
NM_001164980.1 - Saccoglossus kowalevskii - NCBI
Ixodes scapularis homeobox protein, putative, mRNA. (201 bp)
VectorBase:ISCW020382" CDS 1..201 /locus_tag="IscW_ISCW020382" /note="encoded by transcript IscW_ISCW020382-RA" /codon_start=1 /product="homeobox protein, putative" /protein_id="XP_002402536.1" /db_xref="GI:241569185" /db_xref="VectorBase:ISCW020382-PA" /db_xref="GeneID:8033067" /db_xref="VectorBase:ISCW020382" /translation="MGRYFSTFQKEQLTKAFVCNAYPDTAQQRTLAFRLGLTTEQVKVWFANKRTRDRKRAVLFPELRLF" misc_feature 13..162 /locus_tag="IscW_ISCW020382" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 201) AUTHORS Nene,V. CONSRTM Ixodes scapularis...
XM_002402492.1 - Ixodes scapularis (black-legged tick) - NCBI
Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. (2551 bp)
LOCUS NM_001164940 2551 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. ACCESSION NM_001164940 VERSION NM_001164940.1 GI:259013409 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="hox9/10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1170..1331 /gene="hox9/10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1170..1172,1179..1181,1299..1301,1308..1313, 1320..1322) /gene="hox9/10" /note="...
NM_001164940.1 - Saccoglossus kowalevskii - NCBI
Ixodes scapularis homeobox protein mox, putative, mRNA. (180 bp)
VectorBase:ISCW024860" CDS 180 /locus_tag="IscW_ISCW024860" /note="encoded by transcript IscW_ISCW024860-RA" /codon_start=1 /product="homeobox protein mox, putative" /protein_id="XP_002415595.1" /db_xref="GI:241847107" /db_xref="VectorBase:ISCW024860-PA" /db_xref="GeneID:8042510" /db_xref="VectorBase:ISCW024860" /translation="PRKERTAFSKHQVQELESEFAQRNYLTRLRRYEIALALDLTERQVRALYELSTSCARKDA" misc_feature 13..>138 /locus_tag="IscW_ISCW024860" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 180) AUTHORS Nene,V. CONSRTM Ixodes scapularis...
XM_002415550.1 - Ixodes scapularis (black-legged tick) - NCBI
Saccoglossus kowalevskii homeobox 2 (hox2), mRNA. (3042 bp)
LOCUS NM_001164937 3042 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 2 (hox2), mRNA. ACCESSION NM_001164937 VERSION NM_001164937.1 GI:259013403 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="hox2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 976..1134 /gene="hox2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 3042) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164937.1 - Saccoglossus kowalevskii - NCBI
Ixodes scapularis emx homeobox protein, putative, mRNA. (213 bp)
ISCW012144" CDS 1..213 /locus_tag="IscW_ISCW012144" /note="encoded by transcript IscW_ISCW012144-RA" /codon_start=1 /product="emx homeobox protein, putative" /protein_id="XP_002414084.1" /db_xref="GI:241738528" /db_xref="VectorBase:ISCW012144-PA" /db_xref="GeneID:8040230" /db_xref="VectorBase:ISCW012144" /translation="MPKEGPEPAGFLLHPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQVEDARLSF" misc_feature 67..>189 /locus_tag="IscW_ISCW012144" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 213) AUTHORS Nene,V. CONSRTM Ixodes scapularis...
XM_002414039.1 - Ixodes scapularis (black-legged tick) - NCBI
Felis catus Nanog homeobox (NANOG), mRNA. (936 bp)
LOCUS NM_001173442 936 bp mRNA linear MAM 18-APR-2013 DEFINITION Felis catus Nanog homeobox (NANOG), mRNA. ACCESSION NM_001173442 VERSION NM_001173442.1 GI:291045283 KEYWORDS RefSeq. SOURCE Felis catus (domestic cat) ORGANISM Felis catus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NANOG" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 298..456 /gene="NANOG" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" variation 219 /gene="NANOG" /replace="c" /replace="t" /db_xref="dbSNP:786032106" variation...
NM_001173442.1 - Felis catus (domestic cat) - NCBI
Salmo salar homeobox protein HoxB9ab (hoxb9ab), mRNA. (1216 bp)
LOCUS NM_001141626 1216 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxB9ab (hoxb9ab), mRNA. ACCESSION NM_001141626 VERSION NM_001141626.1 GI:213514631 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata;...gene="hoxb9ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 651..812 /gene="hoxb9ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(651..653,660..662,780..782,789..794,801..803) /gene="hoxb9ab" /note="specific DNA...
NM_001141626.1 - Salmo salar (Atlantic salmon) - NCBI
Salmo salar homeobox protein HoxC11ab (hoxc11ab), mRNA. (1046 bp)
LOCUS NM_001141665 1046 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxC11ab (hoxc11ab), mRNA. ACCESSION NM_001141665 VERSION NM_001141665.1 GI:213515377 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata;...gene="hoxc11ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 809..970 /gene="hoxc11ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(809..811,818..820,938..940,947..952,959..961) /gene="hoxc11ab" /note="specific DNA...
NM_001141665.1 - Salmo salar (Atlantic salmon) - NCBI
Ixodes scapularis retinal homeobox protein, putative, mRNA. (384 bp)
tag="IscW_ISCW014108" /note="encoded by transcript IscW_ISCW014108-RA" /codon_start=1 /product="retinal homeobox protein, putative" /protein_id="XP_002416102.1" /db_xref="GI:241857581" /db_xref="VectorBase:ISCW014108-PA" /db_xref="GeneID:8043141" /db_xref="VectorBase:ISCW014108" /translation="MNDFRKHICTDFVERLAAESDLLRKIVTTGFELSSGPELSPGTGSRGSPGPEVAAPVTSECGQTPSANKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVRTFS" misc_feature 241..>369 /locus_tag="IscW_ISCW014108" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 384) AUTHORS Nene,V....
XM_002416057.1 - Ixodes scapularis (black-legged tick) - NCBI
Bos taurus orthopedia homeobox (OTP), mRNA. (2686 bp)
NM_001103312.1 - Bos taurus (cattle) - NCBI
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_475530) mRNA, complete cds. (858 bp)
LOCUS XM_004255584 858 bp mRNA linear INV 26-MAR-2013 DEFINITION Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_475530) mRNA, complete cds. ACCESSION XM_004255584 VERSION XM_004255584.1 GI:471197420 KEYWORDS RefSeq. SOURCE Entamoeba invadens IP1 ORGANISM Entamoeba invadens IP1...containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature 709..828 /locus_tag="EIN_475530" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 858) AUTHORS Zafar,N., Inman,J., Hall,N., Lorenzi,H...
XM_004255584.1 - Entamoeba invadens IP1 - NCBI
PREDICTED: Tursiops truncatus paired-like homeobox 2b (PHOX2B), mRNA. (495 bp)
includes similarity to: 4 Proteins" /db_xref="GeneID:101332091" CDS 1..495 /gene="PHOX2B" /codon_start=1 /product="paired mesoderm homeobox protein 2B" /protein_id="XP_004310749.1" /db_xref="GI:470595650" /db_xref="GeneID:101332091" /translation="MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELDRVFAETHYPDIYTREELALKIDLTEARVQVRAPGSRSGFAASRGAGVQCG" misc_feature 304..>432 /gene="PHOX2B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
XM_004310701.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (360 bp)
IscW_ISCW002094-RA; Gene spans sequencing gaps and may be missing exons." /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002408990.1" /db_xref="GI:241161795" /db_xref="VectorBase:ISCW002094-PA" /db_xref="GeneID:8027604" /db_xref="VectorBase:ISCW002094" /translation="MFGKLWELETSATSPTSAATGTASTPGPGRGRLSVSPVNGASGDCADKAARKKKARTTFTGRQIFELEKQFEIKKYLSSSERAEMAKLLNVTETQGCRGITFGVVKLNTKNSANEGSPH" misc_feature 169..>285 /locus_tag="IscW_ISCW002094" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 360) AUTHORS Nene,V....
XM_002408946.1 - Ixodes scapularis (black-legged tick) - NCBI
Ixodes scapularis homeobox protein Pknox1, putative, mRNA. (912 bp)
XM_002411438.1 - Ixodes scapularis (black-legged tick) - NCBI
PREDICTED: Tursiops truncatus short stature homeobox protein-like (LOC101336911), partial mRNA. (209 bp)
method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:101336911" CDS 209 /gene="LOC101336911" /codon_start=3 /product="short stature homeobox protein-like" /protein_id="XP_004331841.1" /db_xref="GI:470660586" /db_xref="GeneID:101336911" /translation="IYDCKEKREDVKSEDEDGQTKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQ" misc_feature 81..>209 /gene="LOC101336911" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
XM_004331793.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Gallus gallus homeobox C9 (HOXC9), mRNA. (824 bp)
LOCUS NM_001277282 824 bp mRNA linear VRT 27-AUG-2013 DEFINITION Gallus gallus homeobox C9 (HOXC9), mRNA. ACCESSION NM_001277282 XM_423451 VERSION NM_001277282.1 GI:471434841 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived...
Synonym: HOXC8
NM_001277282.1 - Gallus gallus (chicken) - NCBI - UCSC
Ixodes scapularis nk-6 homeobox protein, putative, mRNA. (390 bp)
IscW_ISCW014430-RA; Gene spans sequencing gaps and may be missing exons." /codon_start=1 /product="nk-6 homeobox protein, putative" /protein_id="XP_002416171.1" /db_xref="GI:241859011" /db_xref="VectorBase:ISCW014430-PA" /db_xref="GeneID:8043228" /db_xref="VectorBase:ISCW014430" /translation="MASADSRPNIEQPPHSQCVAGDPLGKQLRPGSSPHSGVAQNCLDKDGKKKHTRPTFSGHQIYVLEKTFEQTKYLAGPERAKLAYALGMSERIQSGPLRRETPRPQAGHADVGSCIVAGGKPTLFRHVVT" misc_feature 154..>273 /locus_tag="IscW_ISCW014430" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 390) AUTHORS...
XM_002416126.1 - Ixodes scapularis (black-legged tick) - NCBI
Ixodes scapularis homeobox protein arx, putative, mRNA. (621 bp)
by transcript IscW_ISCW017713-RA" /codon_start=1 /product="homeobox protein arx, putative" /protein_id="XP_002404118.1" /db_xref="GI:241254920" /db_xref="VectorBase:ISCW017713-PA" /db_xref="GeneID:8029252" /db_xref="VectorBase:ISCW017713" /translation="MRAPRGTHLTVVVGSPTQSSSPLDYRCHASPTRPTTSPREAMGLSDRGDPPCANEGPQLPSVQTNPRTATPASSDALCHRITSTSLTGGGRFDLVATADDGDRSSARRPTPPTPVANAVANHHHHHQQNQHQSSHQSHQGQHHQQQNHTSSSGRASMLMRPDSPQEMTDDFPKRKQRRYRTTFTSYQLEELEKAFSRTHYPDVFTR" misc_feature 538..>618 /locus_tag="IscW_ISCW017713" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
XM_002404074.1 - Ixodes scapularis (black-legged tick) - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (228 bp)
ISCW024267" CDS <1..228 /locus_tag="IscW_ISCW024267" /note="encoded by transcript IscW_ISCW024267-RA" /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002433688.1" /db_xref="GI:241998090" /db_xref="VectorBase:ISCW024267-PA" /db_xref="GeneID:8050402" /db_xref="VectorBase:ISCW024267" /translation="VRKPKAAPDNSPHKNHRGTSKKPRRRRTAFTQSQLAFLENKFRYQKYLSVSDRGSVAEALHLTETQVKTWYQNRR" misc_feature 76..225 /locus_tag="IscW_ISCW024267" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(76..78,85..87,205..207,214..219) /locus_tag="IscW_...
XM_002433643.1 - Ixodes scapularis (black-legged tick) - NCBI
Salmo salar homeobox protein HoxC5ba (hoxc5ba), mRNA. (806 bp)
LOCUS NM_001141621 806 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxC5ba (hoxc5ba), mRNA. ACCESSION NM_001141621 VERSION NM_001141621.1 GI:213513735 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata;...gene="hoxc5ba" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 553..714 /gene="hoxc5ba" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(553..555,562..564,682..684,691..696,703..705) /gene="hoxc5ba" /note="specific DNA...
NM_001141621.1 - Salmo salar (Atlantic salmon) - NCBI
Ixodes scapularis Iroquois-class homeobox protein IRX, putative, mRNA. (200 bp)
encoded by transcript IscW_ISCW012614-RA; Gene spans sequencing gaps and may be missing exons." /codon_start=3 /product="Iroquois-class homeobox protein IRX, putative" /protein_id="XP_002413093.1" /db_xref="GI:241696679" /db_xref="VectorBase:ISCW012614-PA" /db_xref="GeneID:8039004" /db_xref="VectorBase:ISCW012614" /translation="KRHERTTNTLKAWLYEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNK" misc_feature 39..158 /locus_tag="IscW_ISCW012614" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" STS 44..108 /locus_tag="IscW_ISCW012614" /standard_name="Irx3" /db_xref...
XM_002413048.1 - Ixodes scapularis (black-legged tick) - NCBI
PREDICTED: Tursiops truncatus mohawk homeobox (MKX), mRNA. (3199 bp)
XM_004330689.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Aspergillus niger CBS 513.88 homeobox and C2H2 transcription factor, mRNA. (1668 bp)
LOCUS XM_001396061 1668 bp mRNA linear PLN 03-MAR-2011 DEFINITION Aspergillus niger CBS 513.88 homeobox and C2H2 transcription factor, mRNA. ACCESSION XM_001396061 VERSION XM_001396061.2 GI:317034148 KEYWORDS RefSeq. SOURCE Aspergillus niger CBS 513.88 ORGANISM Aspergillus niger CBS 513.88 Eukaryota...note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 601..720 /locus_tag="ANI_1_2360104" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN //...
XM_001396061.2 - Aspergillus niger CBS 513.88 - NCBI
PREDICTED: Tursiops truncatus paired-like homeobox 2a (PHOX2A), mRNA. (721 bp)
gene="PHOX2A" /note="upstream in-frame stop codon" CDS 179..721 /gene="PHOX2A" /codon_start=1 /product="paired mesoderm homeobox protein 2A" /protein_id="XP_004322494.1" /db_xref="GI:470633551" /db_xref="GeneID:101317751" /translation="MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQSDAWEARTEAEWIEGQLQVASGPNKAEQWGKASQRLQVPSSALQR" misc_feature 458..>583 /gene="PHOX2A" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
XM_004322446.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Ixodes scapularis homeobox protein, putative, mRNA. (486 bp)
IscW_ISCW005275" /note="encoded by transcript IscW_ISCW005275-RA" /codon_start=1 /product="homeobox protein, putative" /protein_id="XP_002435834.1" /db_xref="GI:242002382" /db_xref="VectorBase:ISCW005275-PA" /db_xref="GeneID:8052610" /db_xref="VectorBase:ISCW005275" /translation="MHSVCPATTALPAAPSDQGSLTPRGAAFTIEALLGLGPASPDSSTPAGPDRGPSPCHERRRGADSARRHGEPRARRVRTIFTADQLERLEAEFERQQYMVGPERLYLAAALRSPRHSQGVFQTAHQVRNSTSTCSARARAASSRHRRSCDGARPLRSRDCT" misc_feature 333 /locus_tag="IscW_ISCW005275" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1...
XM_002435789.1 - Ixodes scapularis (black-legged tick) - NCBI
PREDICTED: Tursiops truncatus NK2 homeobox 5 (NKX2-5), mRNA. (1669 bp)
XM_004315989.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Ixodes scapularis homeobox protein arx, putative, mRNA. (939 bp)
XM_002405539.1 - Ixodes scapularis (black-legged tick) - NCBI
Aspergillus niger CBS 513.88 homeobox transcription factor, mRNA. (1324 bp)
LOCUS XM_001402019 1324 bp mRNA linear PLN 03-MAR-2011 DEFINITION Aspergillus niger CBS 513.88 homeobox transcription factor, mRNA. ACCESSION XM_001402019 VERSION XM_001402019.2 GI:317038715 KEYWORDS RefSeq. SOURCE Aspergillus niger CBS 513.88 ORGANISM Aspergillus niger CBS 513.88 Eukaryota; Fungi;...specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1070..1189 /locus_tag="ANI_1_2004184" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN //...
XM_001402019.2 - Aspergillus niger CBS 513.88 - NCBI
PREDICTED: Tursiops truncatus H2.0-like homeobox protein-like (LOC101320091), mRNA. (978 bp)
XM_004325225.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus ladybird homeobox 2 (LBX2), mRNA. (453 bp)
modified relative to its source genomic sequence to represent the inferred complete CDS: deleted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: ladybird homeobox 2" /protein_id="XP_004332195.1" /db_xref="GI:470643838" /db_xref="GeneID:101328898" /translation="MKRRFVFQKYLAPSERDGLAARLGLANAQVVTWFQNRRAKLKRDVEEMRADLASLRSLSPEIQCRLALPDGAPGLCPGPARPDSGPRLSDEEIQVED" misc_feature <1..126 /gene="LBX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
XM_004332147.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Ixodes scapularis paired mesoderm homeobox 2B, putative, mRNA. (516 bp)
spans sequencing gaps and may be missing exons." /codon_start=1 /product="paired mesoderm homeobox 2B, putative" /protein_id="XP_002412331.1" /db_xref="GI:241735169" /db_xref="VectorBase:ISCW021525-PA" /db_xref="GeneID:8037399" /db_xref="VectorBase:ISCW021525" /translation="MADKKKNCEGQDSIHCCRLQRCQRADTGGGREREGTGALRLGSAAAPTAHARLPTFPTAVLPFPNFPILLSFSLKELERAFQETHYPDIYTREEIAMKTDLTEARVQASYKTEQTTRHTVGEKDRDGFIPPGRRREDLHANPPSIVAAAIFNRTTIDAARDGISRLGQQRS" misc_feature 321 /locus_tag="IscW_ISCW021525" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1...
XM_002412286.1 - Ixodes scapularis (black-legged tick) - NCBI
PREDICTED: Tursiops truncatus homeobox protein aristaless-like 4-like (LOC101318731), partial mRNA. (860 bp)
CDS 99..>860 /gene="LOC101318731" /codon_start=1 /product="homeobox protein aristaless-like 4-like" /protein_id="XP_004324232.1" /db_xref="GI:470637924" /db_xref="GeneID:101318731" /translation="MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAYPGGDKFSTTFLSAAAKGQGFGDAKSRARYGAGQQDLAAPLESGAGARGSFNKFQPQSPAPQPPPPQPQPPPQPPAQQPHLYLQRGACKTPPDGSLKLQEGGGGHSAALQVPCYAKESSLGEPELPPDSDTVGMDSSYLSVKEAGVKGPQDRASTDLPSPLEKADSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQ" misc_feature 735..>860 /gene="LOC101318731" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
XM_004324184.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Xenopus (Silurana) tropicalis homeobox C10 (hoxc10), mRNA. (1764 bp)
LOCUS NM_001271307 1764 bp mRNA linear VRT 18-APR-2013 DEFINITION Xenopus (Silurana) tropicalis homeobox C10 (hoxc10), mRNA. ACCESSION NM_001271307 XM_002936648 VERSION NM_001271307.1 GI:404351676 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota...gene="hoxc10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 862..1023 /gene="hoxc10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(862..864,871..873,991..993,1000..1005,1012..1014) /gene="hoxc10" /note="specific DNA...
NM_001271307.1 - Xenopus tropicalis (tropical clawed frog) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.129 | 0.129 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.207 | 0.078 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.213 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]