GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2017-07-25 07:31:12, GGRNA : RefSeq release 81 (Mar, 2017)



Matches are highlighted with green background. Overlapping matches are dark colored.

Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Rattus norvegicus reproductive homeobox 7 (Rhox7), mRNA. (900 bp)
reproductive homeobox 7" /protein_id="NP_001020825.1" /db_xref="GeneID:298353" /db_xref="RGD:1563189" /translation="MWFSNRRAKERACEKKAMPRSIPGAKAQMILPAGEGRNGEESERSSPGQEASATKWGEVEELGERDRTGSDGENLSAVGTSGIRNDWDKEGASSSRQKNESRPQKPVPECRWGMEDVQPVPVLIPRVQRIQLVQSRVQSVPLKVPTPRIRPVAVSATTVQPEPVLVPRRHLHDRFTDPELQELERERVFQRNHYLSAEERKELARVMGVSEAKVQRWFKKRREHFRREQSQSGGAPPGNTPPLSEDGAGALVYHP" misc_feature order(520..522,646..648,655..660,667..669) /gene="Rhox7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..666 /gene="Rhox7" /note="Homeobox domain; Region...
NM_001025654.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Oncorhynchus mykiss caudal-type homeobox protein 1 (cdx1), mRNA. (1497 bp)
cdx1" /inference="non-experimental evidence, no additional details recorded" /note="Region: homeobox" misc_feature order(545..556,560..562,611..613,629..631,668..670, 674..679,686..691,695..703,707..712) /gene="cdx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(548..550,557..559,677..679,686..691,698..700) /gene="cdx1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 551..709 /gene="cdx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 563..607 /gene="cdx1" /...
NM_001124632.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. (1821 bp)
LOCUS NM_001165009 1821 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. ACCESSION NM_001165009 VERSION NM_001165009.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="drgx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..692 /gene="drgx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001165009.1 - Saccoglossus kowalevskii - NCBI
Oncorhynchus mykiss hematopoietically expressed homeobox (hhex), mRNA. (1172 bp)
BT073862.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1172 /organism="Oncorhynchus mykiss" /mol_type="mRNA" /db_xref="taxon:8022" gene 1..1172 /gene="hhex" /note="hematopoietically expressed homeobox" /db_xref="GeneID:100305190" misc_feature 95..97 /gene="hhex" /note="upstream in-frame stop codon" CDS 116..964 /gene="hhex" /note="Homeobox protein PRH" /codon_start=1 /product="hematopoietically-expressed homeobox protein hhex" /protein_id="NP_001158566.1" /db_xref="GeneID:100305190" /translation="...
NM_001165094.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (886 bp)
t="homeobox protein MIXL1" /protein_id="NP_990321.1" /db_xref="CGNC:66215" /db_xref="GeneID:395838" /translation="MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLASLPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL" misc_feature order(176..190,194..196,245..247,263..265,302..304, 308..313,320..325,329..337,341..346) /gene="MIXL1" /gene_synonym="CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 182..343 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox...
Synonym: CMIX
NM_204990.1 - Gallus gallus (chicken) - NCBI - UCSC
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 8..75 /gene="HOXA6" /standard_name="Hoxa6" /db_xref="UniSTS:536644" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Sus scrofa mesenchyme homeobox 2 (MEOX2), mRNA. (915 bp)
LOCUS NM_214121 915 bp mRNA linear MAM 18-APR-2013 DEFINITION Sus scrofa mesenchyme homeobox 2 (MEOX2), mRNA. ACCESSION NM_214121 VERSION NM_214121.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 571..729 /gene="MEOX2" /gene_synonym="GAX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 256..406 /gene="MEOX2" /gene_synonym="GAX" /standard_name="MEOX2" /db_xref="UniSTS:503608"...
Synonym: GAX
NM_214121.1 - Sus scrofa (pig) - NCBI
Sus scrofa distal-less homeobox 5 (DLX5), mRNA. (870 bp)
NM_001159660.1 - Sus scrofa (pig) - NCBI
Rattus norvegicus Mix paired-like homeobox 1 (Mixl1), mRNA. (2342 bp)
product="homeobox protein MIXL1" /protein_id="NP_001099449.1" /db_xref="GeneID:289311" /db_xref="RGD:1310011" /translation="MAAAGSQQLQFAEGAAFPTFPAAHPGGQLLPAARPATGLPPAPPDSRAPAATPCFPSRGPRPAAQTPTGLDPPGPSKGSAAPSAPQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLSSRREDFLHRPAPGTEARCLKPQLPLEADVNHVLDSSMAGGGVCTSGSQGFETYSSLSEDIGSKLDSWEEHIFSALGSF" misc_feature order(281..295,299..301,350..352,368..370,407..409, 413..418,425..430,434..442,446..451) /gene="Mixl1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 287..448 /gene="Mixl1" /note="Homeobox domain...
NM_001105979.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox D13 (HOXD13), mRNA. (1964 bp)
LOCUS NM_205434 1964 bp mRNA linear VRT 02-MAR-2017 DEFINITION Gallus gallus homeobox D13 (HOXD13), mRNA. ACCESSION NM_205434 XM_429309 VERSION NM_205434.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 719..880 /gene="HOXD13" /gene_synonym="chox-4.8; chox-4G" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(719..721,728..730,848..850,857..862,869..871) /gene="HOXD13" /gene_...
Synonym: chox-4.8; chox-4G
NM_205434.1 - Gallus gallus (chicken) - NCBI - UCSC
Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. (2158 bp)
LOCUS NM_001164939 2158 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. ACCESSION NM_001164939 VERSION NM_001164939.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 487..645 /gene="hox6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2158) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164939.1 - Saccoglossus kowalevskii - NCBI
Rattus norvegicus ventral anterior homeobox 2 (Vax2), mRNA. (879 bp)
misc_feature 220..303 /gene="Vax2" /note="Region: vax upstream domain" misc_feature 304..483 /gene="Vax2" /note="Region: homeobox" misc_feature order(307..321,325..327,376..378,394..396,433..435, 439..444,451..456,460..468,472..477) /gene="Vax2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 313..474 /gene="Vax2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(313..315,322..324,442..444,451..456,463..465) /gene="Vax2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_...
NM_022637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Xenopus laevis VENT homeobox 3, gene 2 S homeolog (ventx3.2.S), mRNA. (1072 bp)
vex1; xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1072) AUTHORS Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and Richardson P. TITLE Genetic and genomic tools for Xenopus research: The NIH Xenopus initiative JOURNAL Dev. Dyn. 225 (4), 384-391 (2002) PUBMED 12454917 REFERENCE 2 (bases 1 to 1072) AUTHORS Shapira E, Marom1 K, Levy V, Yelin R and Fainsod A. TITLE The Xvex-1 antimorph reveals the temporal competence for organizer formation and an early role for ventral homeobox genes JOURNAL Mech. Dev...
Synonym: ventx3.2; vex1; xvex-1
NM_001088485.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis GS homeobox 1 (gsx1), mRNA. (1456 bp)
gsh-1; gsh1; Xgsh1" /note="Region: homeobox" misc_feature order(553..567,571..573,622..624,640..642,679..681, 685..690,697..702,706..714,718..723) /gene="gsx1" /gene_synonym="gsh-1; gsh1; Xgsh1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(559..561,568..570,688..690,697..702,709..711) /gene="gsx1" /gene_synonym="gsh-1; gsh1; Xgsh1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 562..720 /gene="gsx1" /gene_synonym="gsh-1; gsh1; Xgsh1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="...
Synonym: gsh-1; gsh1; Xgsh1
NM_001045789.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 KEYWORDS RefSeq. SOURCE Takifugu rubripes (Fugu rubripes) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata; Craniata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (Fugu rubripes) - NCBI
Ovis aries homeobox C6 (HOXC6), mRNA. (1196 bp)
LOCUS NM_001009335 1196 bp mRNA linear MAM 18-APR-2013 DEFINITION Ovis aries homeobox C6 (HOXC6), mRNA. ACCESSION NM_001009335 VERSION NM_001009335.1 KEYWORDS RefSeq. SOURCE Ovis aries (sheep) ORGANISM Ovis aries Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria;...HOXC6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 199..357 /gene="HOXC6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 58..267 /gene="HOXC6" /standard_name="MARC_44017-44022:1098368610:3" /db_xref="UniSTS...
NM_001009335.1 - Ovis aries (sheep) - NCBI
Oncorhynchus mykiss NK2 homeobox 1b (nkx2.1b), mRNA. (2127 bp)
LOCUS NM_001124224 2127 bp mRNA linear VRT 17-APR-2013 DEFINITION Oncorhynchus mykiss NK2 homeobox 1b (nkx2.1b), mRNA. ACCESSION NM_001124224 VERSION NM_001124224.1 KEYWORDS RefSeq. SOURCE Oncorhynchus mykiss (rainbow trout) ORGANISM Oncorhynchus mykiss Eukaryota; Metazoa; Chordata; Craniata;...gene="nkx2.1b" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 596..757 /gene="nkx2.1b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(596..598,605..607,725..727,734..739,746..748) /gene="nkx2.1b" /note="specific DNA...
NM_001124224.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. (1845 bp)
LOCUS NM_205252 1845 bp mRNA linear VRT 02-MAR-2017 DEFINITION Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. ACCESSION NM_205252 VERSION NM_205252.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..686 /gene="HHEX" /gene_synonym="PROBOX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1845) AUTHORS Obinata A and Akimoto Y. TITLE Involvement of...
Synonym: PROBOX
NM_205252.1 - Gallus gallus (chicken) - NCBI - UCSC
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_053630) mRNA, complete cds. (747 bp)
locus_tag="EIN_053630" /note="encoded by transcript EIN_053630A" /codon_start=1 /product="homeobox protein knotted-1, putative" /protein_id="XP_004259889.1" /db_xref="GeneID:14892326" /translation="MEPTQEVQKVLTECVNKTIDFDQYLKCFEQSLVRPSGDISDQSLMEKVQHVADLVTGEKLLRLNELVQIFNSQAEVLYLYYTSYYTQLVSLLDSQSQKRIVTQDERSYKISCLRALFGNIYSHLKLMFGSNVSSLAPRERKIPTFLSPQISVHSITSQSQPLSKITCKNSLVLSSTKPTKPIFKIDKIKTQSPKTQKIKPLLDWFVLHSNHPYPTEEQKERLGSECGMSPKQVGTWFSNKRNRNKNQN" misc_feature 610..711 /locus_tag="EIN_053630" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1...
XM_004259841.1 - Entamoeba invadens IP1 - NCBI
Gallus gallus homeobox D11 (HOXD11), mRNA. (1006 bp)
LOCUS NM_204620 1006 bp mRNA linear VRT 02-MAR-2017 DEFINITION Gallus gallus homeobox D11 (HOXD11), mRNA. ACCESSION NM_204620 XM_001234561 VERSION NM_204620.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...GHOX4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 709..870 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(709..711,718..720,838..840,847..852,859..861) /gene="HOXD11" /gene_...
Synonym: GHOX4.6
NM_204620.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus ventral anterior homeobox 1 (Vax1), mRNA. (1011 bp)
misc_feature 214..297 /gene="Vax1" /note="Region: vax upstream domain" misc_feature 298..477 /gene="Vax1" /note="Region: homeobox" misc_feature order(301..315,319..321,370..372,388..390,427..429, 433..438,445..450,454..462,466..471) /gene="Vax1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 307..468 /gene="Vax1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(307..309,316..318,436..438,445..450,457..459) /gene="Vax1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_...
NM_022636.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Oryzias latipes GS homeobox 1 (gsx1), mRNA. (1344 bp)
specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 489..647 /gene="gsx1" /gene_synonym="gsh-1; Gsh1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1344) AUTHORS Deschet K, Bourrat F, Chourrout D and Joly JS. TITLE Expression domains of the medaka (Oryzias latipes) Ol-Gsh 1 gene are reminiscent of those of clustered and orphan homeobox genes JOURNAL Dev. Genes Evol. 208 (5), 235-244 (1998) PUBMED 9683739...
Synonym: gsh-1; Gsh1
NM_001104833.1 - Oryzias latipes (Japanese medaka) - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (95 bp)
GeneID:8039835" /db_xref="VectorBase:ISCW012461" CDS 95 /locus_tag="IscW_ISCW012461" /note="encoded by transcript IscW_ISCW012461-RA" /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002413770.1" /db_xref="VectorBase:ISCW012461-PA" /db_xref="GeneID:8039835" /db_xref="VectorBase:ISCW012461" /translation="VDKYLSVSKRMELSATLNLTEVQIKTWFQNRR" misc_feature <4..95 /locus_tag="IscW_ISCW012461" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 95) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project TITLE Direct...
XM_002413725.1 - Ixodes scapularis (black-legged tick) - NCBI
Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. (1822 bp)
LOCUS NM_001164980 1822 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. ACCESSION NM_001164980 VERSION NM_001164980.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 355..474 /gene="tgif1" /gene_synonym="tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 1822) AUTHORS Freeman,R.M. Jr., Wu,M., Cordonnier-...
Synonym: tgif
NM_001164980.1 - Saccoglossus kowalevskii - NCBI
Ixodes scapularis homeobox protein, putative, mRNA. (201 bp)
db_xref="VectorBase:ISCW020382" CDS 1..201 /locus_tag="IscW_ISCW020382" /note="encoded by transcript IscW_ISCW020382-RA" /codon_start=1 /product="homeobox protein, putative" /protein_id="XP_002402536.1" /db_xref="VectorBase:ISCW020382-PA" /db_xref="GeneID:8033067" /db_xref="VectorBase:ISCW020382" /translation="MGRYFSTFQKEQLTKAFVCNAYPDTAQQRTLAFRLGLTTEQVKVWFANKRTRDRKRAVLFPELRLF" misc_feature 13..162 /locus_tag="IscW_ISCW020382" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 201) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project...
XM_002402492.1 - Ixodes scapularis (black-legged tick) - NCBI
Ixodes scapularis homeobox protein mox, putative, mRNA. (180 bp)
db_xref="VectorBase:ISCW024860" CDS 180 /locus_tag="IscW_ISCW024860" /note="encoded by transcript IscW_ISCW024860-RA" /codon_start=1 /product="homeobox protein mox, putative" /protein_id="XP_002415595.1" /db_xref="VectorBase:ISCW024860-PA" /db_xref="GeneID:8042510" /db_xref="VectorBase:ISCW024860" /translation="PRKERTAFSKHQVQELESEFAQRNYLTRLRRYEIALALDLTERQVRALYELSTSCARKDA" misc_feature 13..>138 /locus_tag="IscW_ISCW024860" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 180) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project...
XM_002415550.1 - Ixodes scapularis (black-legged tick) - NCBI
Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. (2551 bp)
LOCUS NM_001164940 2551 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. ACCESSION NM_001164940 VERSION NM_001164940.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox9/10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1170..1331 /gene="hox9/10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1170..1172,1179..1181,1299..1301,1308..1313, 1320..1322) /gene="hox9/10" /note="...
NM_001164940.1 - Saccoglossus kowalevskii - NCBI
Ixodes scapularis emx homeobox protein, putative, mRNA. (213 bp)
xref="VectorBase:ISCW012144" CDS 1..213 /locus_tag="IscW_ISCW012144" /note="encoded by transcript IscW_ISCW012144-RA" /codon_start=1 /product="emx homeobox protein, putative" /protein_id="XP_002414084.1" /db_xref="VectorBase:ISCW012144-PA" /db_xref="GeneID:8040230" /db_xref="VectorBase:ISCW012144" /translation="MPKEGPEPAGFLLHPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQVEDARLSF" misc_feature 67..>189 /locus_tag="IscW_ISCW012144" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 213) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome...
XM_002414039.1 - Ixodes scapularis (black-legged tick) - NCBI
Saccoglossus kowalevskii homeobox 2 (hox2), mRNA. (3042 bp)
LOCUS NM_001164937 3042 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 2 (hox2), mRNA. ACCESSION NM_001164937 VERSION NM_001164937.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 976..1134 /gene="hox2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 3042) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164937.1 - Saccoglossus kowalevskii - NCBI
Gallus gallus caudal type homeobox 2 (CDX2), mRNA. (1460 bp)
LOCUS NM_204311 1460 bp mRNA linear VRT 02-MAR-2017 DEFINITION Gallus gallus caudal type homeobox 2 (CDX2), mRNA. ACCESSION NM_204311 VERSION NM_204311.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="CDX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 776..934 /gene="CDX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1460) AUTHORS Pernaute B, Canon S, Crespo M, Fernandez...
NM_204311.1 - Gallus gallus (chicken) - NCBI - UCSC
Salmo salar homeobox protein HoxB9ab (hoxb9ab), mRNA. (1216 bp)
LOCUS NM_001141626 1216 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxB9ab (hoxb9ab), mRNA. ACCESSION NM_001141626 VERSION NM_001141626.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxb9ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 651..812 /gene="hoxb9ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(651..653,660..662,780..782,789..794,801..803) /gene="hoxb9ab" /note="specific DNA...
NM_001141626.1 - Salmo salar (Atlantic salmon) - NCBI
Xenopus laevis developing brain homeobox 1 S homeolog (dbx1.S), mRNA. (996 bp)
LOCUS NM_001085741 996 bp mRNA linear VRT 02-MAR-2017 DEFINITION Xenopus laevis developing brain homeobox 1 S homeolog (dbx1.S), mRNA. ACCESSION NM_001085741 VERSION NM_001085741.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 526..687 /gene="dbx1.S" /gene_synonym="dbx; dbx-A; dbx1; Xdbx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(526..528,535..537,655..657,664..669,676..678) /gene="dbx1.S" /gene_...
Synonym: dbx; dbx-A; dbx1; Xdbx
NM_001085741.1 - Xenopus laevis (African clawed frog) - NCBI
Salmo salar homeobox protein HoxC11ab (hoxc11ab), mRNA. (1046 bp)
LOCUS NM_001141665 1046 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxC11ab (hoxc11ab), mRNA. ACCESSION NM_001141665 VERSION NM_001141665.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxc11ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 809..970 /gene="hoxc11ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(809..811,818..820,938..940,947..952,959..961) /gene="hoxc11ab" /note="specific DNA...
NM_001141665.1 - Salmo salar (Atlantic salmon) - NCBI
Ixodes scapularis retinal homeobox protein, putative, mRNA. (384 bp)
locus_tag="IscW_ISCW014108" /note="encoded by transcript IscW_ISCW014108-RA" /codon_start=1 /product="retinal homeobox protein, putative" /protein_id="XP_002416102.1" /db_xref="VectorBase:ISCW014108-PA" /db_xref="GeneID:8043141" /db_xref="VectorBase:ISCW014108" /translation="MNDFRKHICTDFVERLAAESDLLRKIVTTGFELSSGPELSPGTGSRGSPGPEVAAPVTSECGQTPSANKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVRTFS" misc_feature 241..>369 /locus_tag="IscW_ISCW014108" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 384) AUTHORS Nene,V. CONSRTM Ixodes...
XM_002416057.1 - Ixodes scapularis (black-legged tick) - NCBI
Bos taurus orthopedia homeobox (OTP), mRNA. (2686 bp)
NM_001103312.1 - Bos taurus (cattle) - NCBI
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_475530) mRNA, complete cds. (858 bp)
LOCUS XM_004255584 858 bp mRNA linear INV 26-MAR-2013 DEFINITION Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_475530) mRNA, complete cds. ACCESSION XM_004255584 VERSION XM_004255584.1 KEYWORDS RefSeq. SOURCE Entamoeba invadens IP1 ORGANISM Entamoeba invadens IP1 Eukaryota;...containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature 709..828 /locus_tag="EIN_475530" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 858) AUTHORS Zafar,N., Inman,J., Hall,N., Lorenzi,H...
XM_004255584.1 - Entamoeba invadens IP1 - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (360 bp)
by transcript IscW_ISCW002094-RA; Gene spans sequencing gaps and may be missing exons." /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002408990.1" /db_xref="VectorBase:ISCW002094-PA" /db_xref="GeneID:8027604" /db_xref="VectorBase:ISCW002094" /translation="MFGKLWELETSATSPTSAATGTASTPGPGRGRLSVSPVNGASGDCADKAARKKKARTTFTGRQIFELEKQFEIKKYLSSSERAEMAKLLNVTETQGCRGITFGVVKLNTKNSANEGSPH" misc_feature 169..>285 /locus_tag="IscW_ISCW002094" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 360) AUTHORS Nene,V. CONSRTM Ixodes...
XM_002408946.1 - Ixodes scapularis (black-legged tick) - NCBI
Gallus gallus mesenchyme homeobox 1 (MEOX1), mRNA. (1931 bp)
LOCUS NM_204765 1931 bp mRNA linear VRT 02-MAR-2017 DEFINITION Gallus gallus mesenchyme homeobox 1 (MEOX1), mRNA. ACCESSION NM_204765 VERSION NM_204765.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 698..856 /gene="MEOX1" /gene_synonym="GGMOXR1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1931) AUTHORS Reijntjes S, Stricker S and Mankoo BS....
Synonym: GGMOXR1
NM_204765.1 - Gallus gallus (chicken) - NCBI - UCSC
Ixodes scapularis homeobox protein Pknox1, putative, mRNA. (912 bp)
XM_002411438.1 - Ixodes scapularis (black-legged tick) - NCBI
Xenopus tropicalis GS homeobox 2 (gsx2), mRNA. (1216 bp)
LOCUS NM_001017168 1216 bp mRNA linear VRT 02-MAR-2017 DEFINITION Xenopus tropicalis GS homeobox 2 (gsx2), mRNA. ACCESSION NM_001017168 VERSION NM_001017168.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 496..654 /gene="gsx2" /gene_synonym="gsh2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" regulatory 1140..1145 /regulatory_class="polyA_signal_sequence" /gene="gsx2" /gene_synonym="...
Synonym: gsh2
NM_001017168.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Ixodes scapularis nk-6 homeobox protein, putative, mRNA. (390 bp)
transcript IscW_ISCW014430-RA; Gene spans sequencing gaps and may be missing exons." /codon_start=1 /product="nk-6 homeobox protein, putative" /protein_id="XP_002416171.1" /db_xref="VectorBase:ISCW014430-PA" /db_xref="GeneID:8043228" /db_xref="VectorBase:ISCW014430" /translation="MASADSRPNIEQPPHSQCVAGDPLGKQLRPGSSPHSGVAQNCLDKDGKKKHTRPTFSGHQIYVLEKTFEQTKYLAGPERAKLAYALGMSERIQSGPLRRETPRPQAGHADVGSCIVAGGKPTLFRHVVT" misc_feature 154..>273 /locus_tag="IscW_ISCW014430" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 390) AUTHORS Nene,V....
XM_002416126.1 - Ixodes scapularis (black-legged tick) - NCBI
Gallus gallus homeobox C9 (HOXC9), mRNA. (824 bp)
LOCUS NM_001277282 824 bp mRNA linear VRT 27-AUG-2013 DEFINITION Gallus gallus homeobox C9 (HOXC9), mRNA. ACCESSION NM_001277282 XM_423451 VERSION NM_001277282.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from...
Synonym: HOXC8
NM_001277282.1 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus laevis paired-like homeobox 2b (phox2b), mRNA. (882 bp)
LOCUS NM_001090914 882 bp mRNA linear VRT 02-MAR-2017 DEFINITION Xenopus laevis paired-like homeobox 2b (phox2b), mRNA. ACCESSION NM_001090914 NM_001090915 VERSION NM_001090914.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata;...phox2b" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 304..462 /gene="phox2b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 882) AUTHORS Talikka M, Stefani G, Brivanlou AH and...
NM_001090914.1 - Xenopus laevis (African clawed frog) - NCBI
Ixodes scapularis homeobox protein arx, putative, mRNA. (621 bp)
note="encoded by transcript IscW_ISCW017713-RA" /codon_start=1 /product="homeobox protein arx, putative" /protein_id="XP_002404118.1" /db_xref="VectorBase:ISCW017713-PA" /db_xref="GeneID:8029252" /db_xref="VectorBase:ISCW017713" /translation="MRAPRGTHLTVVVGSPTQSSSPLDYRCHASPTRPTTSPREAMGLSDRGDPPCANEGPQLPSVQTNPRTATPASSDALCHRITSTSLTGGGRFDLVATADDGDRSSARRPTPPTPVANAVANHHHHHQQNQHQSSHQSHQGQHHQQQNHTSSSGRASMLMRPDSPQEMTDDFPKRKQRRYRTTFTSYQLEELEKAFSRTHYPDVFTR" misc_feature 538..>618 /locus_tag="IscW_ISCW017713" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE...
XM_002404074.1 - Ixodes scapularis (black-legged tick) - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (228 bp)
VectorBase:ISCW024267" CDS <1..228 /locus_tag="IscW_ISCW024267" /note="encoded by transcript IscW_ISCW024267-RA" /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002433688.1" /db_xref="VectorBase:ISCW024267-PA" /db_xref="GeneID:8050402" /db_xref="VectorBase:ISCW024267" /translation="VRKPKAAPDNSPHKNHRGTSKKPRRRRTAFTQSQLAFLENKFRYQKYLSVSDRGSVAEALHLTETQVKTWYQNRR" misc_feature 76..225 /locus_tag="IscW_ISCW024267" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(76..78,85..87,205..207,214..219) /locus_tag="IscW_ISCW024267" /note="...
XM_002433643.1 - Ixodes scapularis (black-legged tick) - NCBI
Salmo salar homeobox protein HoxC5ba (hoxc5ba), mRNA. (806 bp)
LOCUS NM_001141621 806 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxC5ba (hoxc5ba), mRNA. ACCESSION NM_001141621 VERSION NM_001141621.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxc5ba" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 553..714 /gene="hoxc5ba" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(553..555,562..564,682..684,691..696,703..705) /gene="hoxc5ba" /note="specific DNA...
NM_001141621.1 - Salmo salar (Atlantic salmon) - NCBI
Xenopus laevis distal-less homeobox 2 L homeolog (dlx2.L), mRNA. (1086 bp)
Synonym: dll4; dlx2; tes-1; tes1; X-dll2; X-dll4
NM_001090563.2 - Xenopus laevis (African clawed frog) - NCBI
Ixodes scapularis Iroquois-class homeobox protein IRX, putative, mRNA. (200 bp)
note="encoded by transcript IscW_ISCW012614-RA; Gene spans sequencing gaps and may be missing exons." /codon_start=3 /product="Iroquois-class homeobox protein IRX, putative" /protein_id="XP_002413093.1" /db_xref="VectorBase:ISCW012614-PA" /db_xref="GeneID:8039004" /db_xref="VectorBase:ISCW012614" /translation="KRHERTTNTLKAWLYEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNK" misc_feature 39..158 /locus_tag="IscW_ISCW012614" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" STS 44..108 /locus_tag="IscW_ISCW012614" /standard_name="Irx3" /db_xref="UniSTS:498475"...
XM_002413048.1 - Ixodes scapularis (black-legged tick) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.360 | 0.360 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.691 | 0.331 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.696 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]