GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2019-01-20 01:52:13, GGRNA : RefSeq release 91 (Nov, 2018)



Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Zea mays Zmhox1a homeobox protein (hox1a), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 20-OCT-2018 DEFINITION Zea mays Zmhox1a homeobox protein (hox1a), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript exon...
Synonym: GRMZM2G136369; homeobox1; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (583 bp)
LOCUS NR_131758 583 bp RNA linear ROD 26-MAY-2018 DEFINITION Mus musculus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_131758 VERSION NR_131758.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT PREDICTED REFSEQ: This record has not been reviewed and the function is unknown. The reference sequence was derived from AK002860.1. ##Evidence-...
Synonym: 0610040B09Rik; AV302770; Hoxb5/6as
NR_131758.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (886 bp)
t="homeobox protein MIXL1" /protein_id="NP_990321.1" /db_xref="CGNC:66215" /db_xref="GeneID:395838" /translation="MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLASLPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL" misc_feature order(176..190,194..196,245..247,263..265,302..304, 308..313,320..325,329..337,341..346) /gene="MIXL1" /gene_synonym="CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 182..343 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox...
Synonym: CMIX
NM_204990.1 - Gallus gallus (chicken) - NCBI - UCSC
Strongyloides ratti Homeobox domain and Homeobox KN domain and Homeodomain-like-containing protein (SRAE_2000258700), partial mRNA. (1398 bp)
LOCUS XM_024653672 1398 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Homeobox domain and Homeobox KN domain and Homeodomain-like-containing protein (SRAE_2000258700), partial mRNA. ACCESSION XM_024653672 VERSION XM_024653672.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is...
XM_024653672.1 - Strongyloides ratti - NCBI
Gallus gallus H6 family homeobox 3 (HMX3), mRNA. (927 bp)
LOCUS NM_001007985 927 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus H6 family homeobox 3 (HMX3), mRNA. ACCESSION NM_001007985 XM_426755 VERSION NM_001007985.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NKX5-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 550..711 /gene="HMX3" /gene_synonym="NKX5-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(550..552,559..561,679..681,688..693,700..702) /gene="HMX3" /gene_synonym...
Synonym: NKX5-1
NM_001007985.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox 53 (HB53), mRNA. (941 bp)
NA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox,...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9
NM_126068.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 328..1018 /gene="HMX1" /gene_synonym="GH6" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL...
Synonym: GH6
NM_205533.2 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox 3 (HB-3), mRNA. (1564 bp)
; HOMEOBOX PROTEIN" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 875..991 /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="Homeobox...
NM_121519.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..379 /gene="MSX2" /inference="alignment:Splign:2.1.0" exon 380..804 /gene="MSX2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus msh homeobox 2 (MSX2), mRNA. (1107 bp)
LOCUS NM_204559 1107 bp mRNA linear VRT 23-JUN-2018 DEFINITION Gallus gallus msh homeobox 2 (MSX2), mRNA. ACCESSION NM_204559 VERSION NM_204559.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 510..671 /gene="MSX2" /gene_synonym="HOX-8; Msx-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(510..512,519..521,639..641,648..653,660..662) /gene="MSX2" /gene_synonym="...
Synonym: HOX-8; Msx-2
NM_204559.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 27-MAY-2018 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 21-JUL-2018 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Pan troglodytes HESX homeobox 1 (HESX1), mRNA. (558 bp)
codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_001075039.1" /db_xref="GeneID:747229" /db_xref="VGNC:VGNC:1836" /translation="MSPSLQEGAQLGESKPSTCSFSIERILGLDQNKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERALKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE" misc_feature order(325..339,343..345,394..396,412..414,451..453, 457..462,469..474,478..486,490..495) /gene="HESX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 331..492 /gene="HESX1" /note="Homeobox domain; Region: Homeobox...
NM_001081570.1 - Pan troglodytes (chimpanzee) - NCBI
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
sequence (NC_003071). FEATURES Location/Qualifiers source 1..1963 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene 1..1963 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Encodes a protein with similarity to WUS type homeodomain protein. Required for meristem growth and development and acts through positive regulation of WUS. Loss of function phenotypes include embryo lethality, hyponastic cotyledons, reduced...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus msh homeobox 1 (MSX1), mRNA. (1312 bp)
LOCUS NM_205488 1312 bp mRNA linear VRT 26-JUN-2018 DEFINITION Gallus gallus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_205488 XM_444660 VERSION NM_205488.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 569..730 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(569..571,578..580,698..700,707..712,719..721) /gene="MSX1" /gene_synonym...
Synonym: CHOX-7; GHOX-7; HOX-7
NM_205488.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. (1891 bp)
LOCUS NM_001005427 1891 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus mesenchyme homeobox 2 (MEOX2), mRNA. ACCESSION NM_001005427 XM_418692 VERSION NM_001005427.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...MEOX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 605..763 /gene="MEOX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1891) AUTHORS Reijntjes,S., Stricker,S. and Mankoo,B.S....
NM_001005427.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus T cell leukemia homeobox 1 (TLX1), mRNA. (894 bp)
LOCUS NM_205015 894 bp mRNA linear VRT 18-JUL-2018 DEFINITION Gallus gallus T cell leukemia homeobox 1 (TLX1), mRNA. ACCESSION NM_205015 XM_429269 VERSION NM_205015.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...TLX-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 511..672 /gene="TLX1" /gene_synonym="TLX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(511..513,520..522,640..642,649..654,661..663) /gene="TLX1" /gene_synonym="...
Synonym: TLX-1
NM_205015.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus NK2 homeobox 6 (NKX2-6), mRNA. (1111 bp)
uct="homeobox protein Nkx-2.6" /protein_id="NP_990468.1" /db_xref="CGNC:49622" /db_xref="GeneID:396037" /translation="MLPTPFSVEDILSLEQSSAPGAPGVRRSPSVEEEPPSGQCLLSQPLQADQQQTDPCHHPKQPQRRKPRVLFSQTQVLELERRFKQQKYLSALEREHLANVLQLTSTQVKIWFQNRRYKCKRQRQDRSLEMATYPLPPRKVAVPVLVRNGKPCFEGSQPHLAPYGITVSPYSYSTYYSAYGVSYGVGYTGVLTP" misc_feature order(224..238,242..244,293..295,311..313,350..352, 356..361,368..373,377..385,389..394) /gene="NKX2-6" /gene_synonym="NKX2.8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 230..391 /gene="NKX2-6" /gene_synonym="NKX2.8" /note="Homeobox...
Synonym: NKX2.8
NM_205137.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus notochord homeobox (NOTO), mRNA. (1736 bp)
gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 304..462 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1736) AUTHORS Knezevic V, Ranson M and Mackem S. TITLE The organizer-associated chick homeobox gene, Gnot1, is expressed before gastrulation and regulated synergistically by activin and retinoic acid JOURNAL Dev. Biol. 171 (2), 458-470 (1995) PUBMED 7556928 REFERENCE 2 (bases 1 to 1736) AUTHORS...
Synonym: CNOT; GNOT1
NM_205354.1 - Gallus gallus (chicken) - NCBI - UCSC
Bos taurus retina and anterior neural fold homeobox 2 (RAX2), mRNA. (1828 bp)
gene="RAX2" /gene_synonym="QRX" /note="Region: homeobox domain" misc_feature order(130..144,148..150,199..201,217..219,256..258, 262..267,274..279,283..291,295..300) /gene="RAX2" /gene_synonym="QRX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(136..138,145..147,265..267,274..279,286..288) /gene="RAX2" /gene_synonym="QRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 139..297 /gene="RAX2" /gene_synonym="QRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon...
Synonym: QRX
NM_182653.1 - Bos taurus (cattle) - NCBI
Gallus gallus motor neuron and pancreas homeobox 1 (MNX1), mRNA. (1481 bp)
LOCUS NM_204928 1481 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus motor neuron and pancreas homeobox 1 (MNX1), mRNA. ACCESSION NM_204928 VERSION NM_204928.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HLXB9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 577..738 /gene="MNX1" /gene_synonym="HB9; HLXB9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(577..579,586..588,706..708,715..720,727..729) /gene="MNX1" /gene_...
Synonym: HB9; HLXB9
NM_204928.1 - Gallus gallus (chicken) - NCBI - UCSC
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1;...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Pongo abelii Meis homeobox 2 (MEIS2), mRNA. (1735 bp)
NM_001133677.1 - Pongo abelii (Sumatran orangutan) - NCBI
Gallus gallus goosecoid homeobox (GSC), mRNA. (936 bp)
ct="homeobox protein goosecoid" /protein_id="NP_990662.1" /db_xref="CGNC:8338" /db_xref="GeneID:396273" /translation="MPASMFSIDNILAARPRCKDSVLLPPSAPVVFPSLHGDSLYGAASDYGGFYSRAVAPGSALPAVGRSRLGYNNYYYGQLHVATSPVGPSCCGAVPPLGAQQCSCVPPAGYEGAGSVLMSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAQKWNKASKTSPEKRQEDGKSDLDSDS" misc_feature order(451..465,469..471,520..522,538..540,577..579, 583..588,595..600,604..612,616..621) /gene="GSC" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 457..618 /gene="GSC" /note="Homeobox...
NM_205331.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana WUSCHEL related homeobox 5 (WOX5), mRNA. (1052 bp)
WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /note="Arabidopsis thaliana WOX5 protein mRNA" /db_xref="Araport:AT3G11260" /db_xref="GeneID:820297" /db_xref="TAIR:AT3G11260" CDS 327..875 /gene="WOX5" /locus_tag="AT3G11260" /gene_synonym="WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /inference="Similar to RNA sequence, EST:INSD:DR750862.1,INSD:DR751206.1,INSD:DR750861.1, INSD:EH977836.1" /inference="Similar to RNA sequence, mRNA:INSD:AY150812.1,INSD:AY251398.1" /note="WUSCHEL related homeobox 5 (WOX5); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356),...
Synonym: WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B
NM_111961.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 7 (WOX7), partial mRNA. (429 bp)
TAIR:AT5G05770" CDS 61..429 /gene="WOX7" /locus_tag="AT5G05770" /gene_synonym="MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related homeobox 5A; WUSCHEL related homeobox 7" /inference="Similar to RNA sequence, EST:INSD:DR750916.1,INSD:DR751352.1,INSD:DR750917.1" /note="WUSCHEL related homeobox 7 (WOX7); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: WUSCHEL related...
Synonym: MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related homeobox 5A; WUSCHEL related homeobox 7
NM_120659.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
PREDICTED: Pelodiscus sinensis homeobox protein Meis3-like (LOC102448310), partial mRNA. (655 bp)
LOCUS XM_014570120 655 bp mRNA linear VRT 04-JUN-2018 DEFINITION PREDICTED: Pelodiscus sinensis homeobox protein Meis3-like (LOC102448310), partial mRNA. ACCESSION XM_014570120 VERSION XM_014570120.1 DBLINK BioProject: PRJNA221645 KEYWORDS RefSeq; includes ab initio. SOURCE Pelodiscus sinensis...Daiwa-1" /db_xref="taxon:13735" /chromosome="Unknown" /sex="female" /country="Japan: Saga" gene 217 /gene="LOC102448310" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:293102" misc_feature 464..562 /gene="LOC102448310" /note="Homeobox KN domain; Region...
XM_014570120.1 - Pelodiscus sinensis (Chinese softshell turtle) - NCBI
Arabidopsis thaliana homeobox-leucine zipper protein 3 (HAT3), mRNA. (1447 bp)
locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(775..777,784..786,904..906,913..918,925..927) /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 784..936 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3
NM_115903.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus sensory organ homeobox protein SOHo (SOHO-1), mRNA. (1820 bp)
an homeobox protein SOHo" /protein_id="NP_990717.1" /db_xref="CGNC:49762" /db_xref="GeneID:396346" /translation="MVQLGGGRGAPPPLLAPPSAFSIDSILQPGPRCQAREQGRARCALPEDGPAEEHPTKGSTDSGSERLLAEGPRRADAEAEGAVSPLSTERFRGCRQPSLRDTGGCGRESGRCSAAGGKKKTRTIFSKSQVFQLESTFDVKRYLSSAERAGLAAALHLTETQVKIWFQNRRNKLKRQLSAEPEGPGQAEPPGEAASFSFPSLYKDSALFSRCLLPLPFPLFYPGSAIPYLCLPGPVKHFSLLDGDV" misc_feature order(417..431,435..437,486..488,504..506,543..545, 549..554,561..566,570..578,582..587) /gene="SOHO-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 423..584 /gene="SOHO-1" /note="Homeobox...
NM_205386.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox A6 (HOXA6), mRNA. (1467 bp)
LOCUS NM_001030987 1467 bp mRNA linear VRT 26-JUN-2018 DEFINITION Gallus gallus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001030987 XM_418729 VERSION NM_001030987.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 469..627 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..436 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /inference="alignment:...
Synonym: HOX1; HOX1.2; HOX1B
NM_001030987.2 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-3.S), mRNA. (742 bp)
zax; zax-A" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(374..376,383..385,503..505,512..517,524..526) /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 309..742 /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 742) AUTHORS Newman CS and Krieg PA. TITLE The Xenopus bagpipe-related homeobox gene zampogna is expressed in the...
Synonym: bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A
NM_001085685.1 - Xenopus laevis (African clawed frog) - NCBI
Gallus gallus PBX/knotted 1 homeobox 2 (PKNOX2), mRNA. (1434 bp)
LOCUS NM_204226 1434 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus PBX/knotted 1 homeobox 2 (PKNOX2), mRNA. ACCESSION NM_204226 VERSION NM_204226.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...misc_feature 280..531 /gene="PKNOX2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:293102" misc_feature order(862..876,880..882,940..942,958..960,997..999, 1003..1008,1015..1020,1024..1032) /gene="PKNOX2" /note="DNA binding site [nucleotide binding]" /...
NM_204226.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (876 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22" /inference="Similar to RNA sequence, EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1" /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1" /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22
NM_179935.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 12 (HB-12), mRNA. (1054 bp)
." /codon_start=1 /product="homeobox 12" /protein_id="NP_191748.1" /db_xref="GeneID:825362" /db_xref="TAIR:AT3G61890" /db_xref="Araport:AT3G61890" /translation="MEEGDFFNCCFSEISSGMTMNKKKMKKSNNQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQRLNEEMQRPKEEKHHECCGDQGLALSSSTESHNGKSEPEGRLDQGSVLCNDGDYNNNIKTEYFGFEEETDHELMNIVEKADDSCLTSSENWGGFNSDSLLDQSSSNYPNWWEFWS" misc_feature 251..403 /gene="HB-12" /locus_tag="AT3G61890" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
NM_116054.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Xenopus laevis VENT homeobox 3, gene 2 S homeolog (ventx3.2.S), mRNA. (1072 bp)
LOCUS NM_001088485 1072 bp mRNA linear VRT 01-APR-2018 DEFINITION Xenopus laevis VENT homeobox 3, gene 2 S homeolog (ventx3.2.S), mRNA. ACCESSION NM_001088485 NM_001088486 VERSION NM_001088485.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa;...; other site" /db_xref="CDD:238039" misc_feature 448..606 /gene="ventx3.2.S" /gene_synonym="ventx3.2; vex1; xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 308..567 /gene="ventx3.2.S" /gene_synonym="ventx3.2; vex1; xvex-1" /inference="...
Synonym: ventx3.2; vex1; xvex-1
NM_001088485.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus TGFB-induced factor homeobox 2-like, X-linked 2 (Tgif2lx2), mRNA. (1032 bp)
CDS 116..811 /gene="Tgif2lx2" /codon_start=1 /product="TGFB-induced factor homeobox 2-like, X-linked 2" /protein_id="NP_001136222.1" /db_xref="CCDS:CCDS53177.1" /db_xref="GeneID:100039551" /db_xref="MGI:MGI:3800824" /translation="MEEAEGSPEETQDFMKYYSSFGIRLERTCKMKFHDSRELPRGNMLPLKSVKILRDWLCEHQFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHLRWEIRYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNIEKEEKISITEPWSSPEVAWPEEKPDFSSFYMLVDVAVQKAKEMEEQKKQNPNPQGPQQQFM" misc_feature 281..397 /gene="Tgif2lx2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" STS 393..692 /...
NM_001142750.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus caudal type homeobox 2 (CDX2), mRNA. (1460 bp)
LOCUS NM_204311 1460 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus caudal type homeobox 2 (CDX2), mRNA. ACCESSION NM_204311 VERSION NM_204311.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="CDX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 776..934 /gene="CDX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1460) AUTHORS Pernaute B, Canon S, Crespo M, Fernandez...
NM_204311.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana WUSCHEL related homeobox 8 (WOX8), mRNA. (1151 bp)
db_xref="TAIR:AT5G45980" CDS 36..1013 /gene="WOX8" /locus_tag="AT5G45980" /gene_synonym="MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B" /inference="Similar to RNA sequence, EST:INSD:DR750890.1,INSD:AV557790.1,INSD:DR750889.1, INSD:AV556647.1" /inference="similar to RNA sequence, mRNA:INSD:AY251400.1" /note="WUSCHEL related homeobox 8 (WOX8); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: homeobox-3 (TAIR:AT2G33880.1); Has 568 Blast hits to 538...
Synonym: MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B
NM_123966.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. (1845 bp)
LOCUS NM_205252 1845 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. ACCESSION NM_205252 VERSION NM_205252.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..686 /gene="HHEX" /gene_synonym="PROBOX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 469..647 /gene="HHEX" /gene_synonym="PROBOX" /inference="alignment:Splign:2.1.0" exon...
Synonym: PROBOX
NM_205252.1 - Gallus gallus (chicken) - NCBI - UCSC
Bos taurus paired related homeobox 1 (PRRX1), mRNA. (1001 bp)
CDS 246..983 /gene="PRRX1" /note="paired mesoderm homeobox 1" /codon_start=1 /product="paired mesoderm homeobox protein 1" /protein_id="NP_001075208.1" /db_xref="BGD:BT11112" /db_xref="GeneID:540901" /db_xref="VGNC:VGNC:33412" /translation="MTSSYGHVLERQPALGGRLDSPSNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCANNNPAQGINMANSIANLRLKAKEYSLQRNQVPTVN" misc_feature 540..695 /gene="PRRX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475"...
NM_001081739.1 - Bos taurus (cattle) - NCBI
Bos taurus BARX homeobox 2 (BARX2), mRNA. (1836 bp)
LOCUS NM_001101266 1836 bp mRNA linear MAM 14-MAY-2018 DEFINITION Bos taurus BARX homeobox 2 (BARX2), mRNA. ACCESSION NM_001101266 XM_869733 VERSION NM_001101266.1 KEYWORDS RefSeq. SOURCE Bos taurus (cattle) ORGANISM Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="BARX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 677..838 /gene="BARX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(677..679,686..688,806..808,815..820,827..829) /gene="BARX2" /note="specific DNA base...
NM_001101266.1 - Bos taurus (cattle) - NCBI
PREDICTED: Homo sapiens Meis homeobox 3 (MEIS3), transcript variant X8, mRNA. (2165 bp)
Synonym: MRG2
XM_024451617.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. (1036 bp)
LOCUS NM_001129916 1036 bp mRNA linear VRT 23-JUN-2018 DEFINITION Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. ACCESSION NM_001129916 VERSION NM_001129916.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 427..585 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 296..546 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /inference="alignment:...
Synonym: vex1; Xvex-1
NM_001129916.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Gallus gallus brain specific homeobox (BSX), mRNA. (954 bp)
LOCUS NM_204512 954 bp mRNA linear VRT 23-JUN-2018 DEFINITION Gallus gallus brain specific homeobox (BSX), mRNA. ACCESSION NM_204512 VERSION NM_204512.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="BSX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 421..579 /gene="BSX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 344..540 /gene="BSX" /inference="alignment:Splign:2.1.0" exon 541..954 /gene="BSX" /...
NM_204512.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus ladybird homeobox 2 (LBX2), mRNA. (1072 bp)
gene="LBX2" /gene_synonym="LBX3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(584..586,593..595,713..715,722..727,734..736) /gene="LBX2" /gene_synonym="LBX3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 528..1056 /gene="LBX2" /gene_synonym="LBX3" /inference="alignment:Splign:2.0.8" ORIGIN // REFERENCE 1 (bases 1 to 1072) AUTHORS Kanamoto T, Terada K, Yoshikawa H and Furukawa T. TITLE Cloning and expression pattern of lbx3, a novel chick homeobox gene JOURNAL Gene Expr. Patterns...
Synonym: LBX3
NM_001044668.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus BARX homeobox 2 (BARX2), mRNA. (927 bp)
LOCUS NM_204896 927 bp mRNA linear VRT 21-MAY-2018 DEFINITION Gallus gallus BARX homeobox 2 (BARX2), mRNA. ACCESSION NM_204896 VERSION NM_204896.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...BARX2B" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 460..621 /gene="BARX2" /gene_synonym="BARX2B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(460..462,469..471,589..591,598..603,610..612) /gene="BARX2" /gene_...
Synonym: BARX2B
NM_204896.1 - Gallus gallus (chicken) - NCBI - UCSC

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.166 | 0.166 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.308 | 0.142 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.314 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]