GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-09-25 17:17:01, GGRNA : RefSeq release 212 (May, 2022)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1770 bp)
LOCUS NM_006562 1770 bp mRNA linear PRI 21-APR-2022 DEFINITION Homo sapiens ladybird homeobox 1 (LBX1), mRNA. ACCESSION NM_006562 VERSION NM_006562.5 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL135794.19. On Sep 30, 2020 this sequence version replaced NM_006562.4. Summary: This gene and...
Synonym: CCHS3; homeobox; HPX-6; HPX6; LBX1H
NM_006562.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 25-FEB-2022 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000220.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 12-JAN-2022 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
misc_feature 341..523 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" ORIGIN // REFERENCE 1 (bases 1 to 1963) AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D., Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V., Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L., Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L., Tallon,L.J., Gill,J.E., Adams,M.D...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="propagated from UniProtKB/Swiss-Prot (Q01703.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
2; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="propagated from UniProtKB/Swiss-Prot (Q804R0.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..858 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 53 (HB53), mRNA. (941 bp)
NA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox,...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9
NM_126068.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 3 (HB-3), mRNA. (1564 bp)
; HOMEOBOX PROTEIN" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 875..991 /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="Homeobox...
Synonym: ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN
NM_121519.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_synonym="GH6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 328..1018 /gene="HMX1" /gene_synonym="GH6" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1018) AUTHORS Schulte D and Cepko CL. TITLE Two homeobox genes define the domain of EphA3 expression in the developing chick retina JOURNAL...
Synonym: GH6
NM_205533.3 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (876 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22" /inference="Similar to RNA sequence, EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1" /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1" /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22
NM_179935.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 4 (HB4), mRNA. (1394 bp)
gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 702..854 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 858..989 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8
NM_130055.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (1018 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /inference="Similar to RNA sequence, EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1, INSD:DR751539.1" /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1" /note="homeobox-leucine zipper protein 17 (HB17); FUNCTIONS IN: sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_126204.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Homo sapiens tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 1, mRNA. (1127 bp)
tetrapeptide repeat homeobox 2 (TPRX2), transcript variant 1, mRNA. ACCESSION NM_001397347 VERSION NM_001397347.2 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC024582.7. On Nov 10, 2021 this sequence version replaced NM_001397347.1. Summary: Homeobox genes encode DNA-...
Synonym: TPRX2P; TPRX2P1; TPRXP1
NM_001397347.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (2359 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..2359 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene <1..2359 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /db_xref="Araport:AT2G01430" /db_xref="GeneID:814671" /db_xref="TAIR:AT2G01430" CDS 1..642 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_001335062.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 21 (HB21), mRNA. (1058 bp)
INSD:DR750746.1,INSD:DR750857.1,INSD:DR750745.1" /inference="similar to RNA sequence, mRNA:INSD:BT031362.1,INSD:BT031368.1" /note="homeobox protein 21 (HB21); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Helix-turn-helix motif, lambda...
Synonym: ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2
NM_127411.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1308 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(270..272,279..281,399..401,408..413,420..422) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 279..431 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6
NM_001036473.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus homeobox A6 (HOXA6), transcript variant 2, mRNA. (880 bp)
LOCUS NM_001398309 880 bp mRNA linear VRT 14-DEC-2021 DEFINITION Gallus gallus homeobox A6 (HOXA6), transcript variant 2, mRNA. ACCESSION NM_001398309 VERSION NM_001398309.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived...
Synonym: HOX1; HOX1.2; HOX1B
NM_001398309.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana WUSCHEL related homeobox 10 (WOX10), partial mRNA. (594 bp)
db_xref="TAIR:AT1G20710" CDS 1..594 /gene="WOX10" /locus_tag="AT1G20710" /gene_synonym="F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B" /note="WUSCHEL related homeobox 10 (WOX10); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is:...
Synonym: F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B
NM_101923.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus homeobox D12 (HOXD12), mRNA. (1332 bp)
LOCUS NM_205249 1332 bp mRNA linear VRT 16-APR-2022 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 608..769 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(608..610,617..619,737..739,746..751,758..760) /gene="HOXD12" /note="specific DNA base...
NM_205249.2 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 12-JAN-2022 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Capsicum annuum homeobox-leucine zipper protein HAT22 (LOC107860150), mRNA. (1064 bp)
HB1" /note="homeodomain leucine-zipper 1" /codon_start=1 /product="homeobox-leucine zipper protein HAT22" /protein_id="NP_001311712.1" /db_xref="GeneID:107860150" /translation="MGFDDICNTGLVLGLGFSSTTDQKSTKITPLASKGPASLTFEPSLTLSLISGDRTYEQQATKKVNVTKPSNDHQSADLYRQDSAASSYSNASVKRERDVGSEETTTEVERVSSRVISDEDDDGSNARKKLRLTKAQSALLEESFKLHSTLNPKQKQDLAMELSLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTEENRRLHKELQELKALKIAQPLYMQLPAATLTMCPSCERIGGGVGENPSKNPFTIAQKPHFYSPFNNPSAAC" misc_feature 391..543 /gene="LOC107860150" /gene_synonym="HB1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_...
Synonym: HB1
NM_001324783.1 - Capsicum annuum - NCBI
Salmo salar homeobox A10b (hoxa10b), mRNA. (1087 bp)
LOCUS NM_001139571 1087 bp mRNA linear VRT 10-JAN-2022 DEFINITION Salmo salar homeobox A10b (hoxa10b), mRNA. ACCESSION NM_001139571 VERSION NM_001139571.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="hoxa10b" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 799..960 /gene="hoxa10b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(799..801,808..810,928..930,937..942,949..951) /gene="hoxa10b" /note="specific DNA...
NM_001139571.1 - Salmo salar (Atlantic salmon) - NCBI
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1474 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(288..290,297..299,417..419,426..431,438..440) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 297..449 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6
NM_130233.5 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (826 bp)
xref="GeneID:838660" /db_xref="TAIR:AT1G20700" CDS 1..636 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /inference="Similar to RNA sequence, EST:INSD:DR751559.1,INSD:AA585837.1,INSD:T22843.1, INSD:DR751560.1" /inference="similar to RNA sequence, mRNA:INSD:AJ441297.1" /note="WUSCHEL related homeobox 14 (WOX14); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: WUSCHEL...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_101922.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. (794 bp)
feature 58..60 /gene="Rhox5" /gene_synonym="Pem" /note="upstream in-frame stop codon" exon 94..175 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" CDS 97..723 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.2" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="...
Synonym: Pem
NM_022175.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Hydra vulgaris homeobox protein OTX2-like (LOC100211908), mRNA. (1355 bp)
LOCUS NM_001309768 1355 bp mRNA linear INV 17-APR-2022 DEFINITION Hydra vulgaris homeobox protein OTX2-like (LOC100211908), mRNA. ACCESSION NM_001309768 VERSION NM_001309768.1 KEYWORDS RefSeq. SOURCE Hydra vulgaris (swiftwater hydra) ORGANISM Hydra vulgaris Eukaryota; Metazoa; Cnidaria; Hydrozoa;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 112..270 /gene="LOC100211908" /gene_synonym="CnOtx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
Synonym: CnOtx
NM_001309768.1 - Hydra vulgaris (swiftwater hydra) - NCBI
Gallus gallus homeobox A5 (HOXA5), mRNA. (1677 bp)
LOCUS NM_001318419 1677 bp mRNA linear VRT 04-DEC-2021 DEFINITION Gallus gallus homeobox A5 (HOXA5), mRNA. ACCESSION NM_001318419 XM_003640699 VERSION NM_001318419.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...; Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 538..>858 /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="Homeobox protein; Region: Abdominal-A; cl27820" /db_xref="CDD:332641" misc_feature 604..621 /gene="HOXA5" /gene_synonym="HOX1.3; HOX1C" /note="propagated...
Synonym: HOX1.3; HOX1C
NM_001318419.2 - Gallus gallus (chicken) - NCBI - UCSC
Pongo abelii Meis homeobox 2 (MEIS2), mRNA. (1735 bp)
start=1 /product="homeobox protein Meis2" /protein_id="NP_001127149.1" /db_xref="GeneID:100174200" /translation="MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSVNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM" misc_feature 499..750 /gene="MEIS2" /note="N-terminal of Homeobox Meis and PKNOX1;...
NM_001133677.1 - Pongo abelii (Sumatran orangutan) - NCBI
Gallus gallus homeobox A6 (HOXA6), transcript variant 1, mRNA. (823 bp)
LOCUS NM_001030987 823 bp mRNA linear VRT 14-DEC-2021 DEFINITION Gallus gallus homeobox A6 (HOXA6), transcript variant 1, mRNA. ACCESSION NM_001030987 XM_418729 VERSION NM_001030987.4 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata;...contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 560..718 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 725..784 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="...
Synonym: HOX1; HOX1.2; HOX1B
NM_001030987.4 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox-leucine zipper protein 3 (HAT3), mRNA. (1447 bp)
misc_feature 346..645 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="HD-ZIP protein N-terminus; Region: HD-ZIP_N; pfam04618" /db_xref="CDD:398351" misc_feature 784..936 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 940..1071 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="homeobox associated leucin zipper; Region: HALZ;...
Synonym: HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3
NM_115903.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus homeobox D8 (HOXD8), mRNA. (1251 bp)
db_xref="CDD:238039" misc_feature 462..623 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 621..731 /gene="HOXD8" /note="propagated from UniProtKB/Swiss-Prot (P23459.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 291..438 /gene="HOXD8" /inference="alignment:Splign:2.1.0" exon 439..1251 /gene="HOXD8" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1251) AUTHORS Crompton MR, MacGregor AD and Goodwin GH. TITLE cDNA cloning of a homeobox-containing gene expressed in avian myeloblastic virus-transformed...
NM_207177.2 - Gallus gallus (chicken) - NCBI - UCSC
Capsicum annuum homeobox-leucine zipper protein ATHB-12-like (LOC107863056), mRNA. (969 bp)
ZIP" /note="homeobox-leucine zipper protein ATHB-12-like" /db_xref="GeneID:107863056" CDS 50..712 /gene="LOC107863056" /gene_synonym="HD-ZIP" /codon_start=1 /product="homeobox-leucine zipper protein ATHB-12-like" /protein_id="NP_001311778.1" /db_xref="GeneID:107863056" /translation="MESEHEKSETPNFKRPLKKKCENAKRFTDEQVKLLESMFKLGTKIEPREKLQLARDLGLQPRQVAIWFQNKRARWKSKQLEHEYRILQSKFDHLNTQFESLKIEKERLLIELETLNDQLGNKLARGSKSQDSRDSELHTSPENGFTDLLELKHCAGCSNSRFGHKSVNEEDDETTEETDKYFTPKEEAEFWNLDELGDNNSLEHWCVGLGSISNSKLWDF" misc_feature 125..277 /gene="LOC107863056" /gene_synonym="HD-ZIP" /note="Homeobox domain;...
Synonym: HD-ZIP
NM_001324849.1 - Capsicum annuum - NCBI
Arabidopsis thaliana homeobox 12 (HB-12), mRNA. (1054 bp)
." /codon_start=1 /product="homeobox 12" /protein_id="NP_191748.1" /db_xref="GeneID:825362" /db_xref="TAIR:AT3G61890" /db_xref="Araport:AT3G61890" /translation="MEEGDFFNCCFSEISSGMTMNKKKMKKSNNQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQRLNEEMQRPKEEKHHECCGDQGLALSSSTESHNGKSEPEGRLDQGSVLCNDGDYNNNIKTEYFGFEEETDHELMNIVEKADDSCLTSSENWGGFNSDSLLDQSSSNYPNWWEFWS" misc_feature 251..403 /gene="HB-12" /locus_tag="AT3G61890" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12
NM_116054.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Hydra vulgaris homeobox protein Hox-D10-like (LOC100197809), mRNA. (1781 bp)
LOCUS NM_001309758 1781 bp mRNA linear INV 17-APR-2022 DEFINITION Hydra vulgaris homeobox protein Hox-D10-like (LOC100197809), mRNA. ACCESSION NM_001309758 VERSION NM_001309758.1 KEYWORDS RefSeq. SOURCE Hydra vulgaris (swiftwater hydra) ORGANISM Hydra vulgaris Eukaryota; Metazoa; Cnidaria; Hydrozoa...binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 511..672 /gene="LOC100197809" /gene_synonym="cnox-1; Cnox-3; hox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(511..513,520..522,640..642,649..654,661..663) /gene="LOC100197809" /...
Synonym: cnox-1; Cnox-3; hox1
NM_001309758.1 - Hydra vulgaris (swiftwater hydra) - NCBI
Homo sapiens tetrapeptide repeat homeobox 1 (TPRX1), transcript variant 2, mRNA. (2070 bp)
collaboration with Anne Booth and Peter Holland. The reference sequence was derived from AC008745.7. On Jul 13, 2021 this sequence version replaced NM_198479.2. Summary: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the TPRX homeobox gene family. [provided by RefSeq, Jul 2008]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the...
Synonym: TPRX
NM_198479.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Gallus gallus NK2 homeobox 6 (NKX2-6), mRNA. (1111 bp)
uct="homeobox protein Nkx-2.6" /protein_id="NP_990468.1" /db_xref="CGNC:49622" /db_xref="GeneID:396037" /translation="MLPTPFSVEDILSLEQSSAPGAPGVRRSPSVEEEPPSGQCLLSQPLQADQQQTDPCHHPKQPQRRKPRVLFSQTQVLELERRFKQQKYLSALEREHLANVLQLTSTQVKIWFQNRRYKCKRQRQDRSLEMATYPLPPRKVAVPVLVRNGKPCFEGSQPHLAPYGITVSPYSYSTYYSAYGVSYGVGYTGVLTP" misc_feature order(224..238,242..244,293..295,311..313,350..352, 356..361,368..373,377..385,389..394) /gene="NKX2-6" /gene_synonym="NKX2.8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 230..391 /gene="NKX2-6" /gene_synonym="NKX2.8" /note="Homeobox...
Synonym: NKX2.8
NM_205137.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana WUSCHEL related homeobox 8 (WOX8), mRNA. (1151 bp)
db_xref="TAIR:AT5G45980" CDS 36..1013 /gene="WOX8" /locus_tag="AT5G45980" /gene_synonym="MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B" /inference="Similar to RNA sequence, EST:INSD:DR750890.1,INSD:AV557790.1,INSD:DR750889.1, INSD:AV556647.1" /inference="similar to RNA sequence, mRNA:INSD:AY251400.1" /note="WUSCHEL related homeobox 8 (WOX8); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: homeobox-3 (TAIR:AT2G33880.1); Has 568 Blast hits to 538...
Synonym: MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B
NM_123966.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus homeo box C6 (Hoxc6), mRNA. (1680 bp)
gene="Hoxc6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 560..721 /gene="Hoxc6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 528..1680 /gene="Hoxc6" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1680) AUTHORS Long X, You G, Wu Q, Zhou Y, Yu F, Xiao Y, Deng S, Song F, Huang J and Tian M. TITLE Abnormal expression of homeobox c6 in the atherosclerotic aorta and its effect on proliferation and migration of rat vascular smooth muscle cells JOURNAL Acta Biochim Biophys Sin...
NM_001398518.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Salmo salar homeobox D12a (hoxd12a), mRNA. (1078 bp)
LOCUS NM_001139551 1078 bp mRNA linear VRT 10-JAN-2022 DEFINITION Salmo salar homeobox D12a (hoxd12a), mRNA. ACCESSION NM_001139551 VERSION NM_001139551.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 645..806 /gene="hoxd12a" /gene_synonym="hoxd12; hoxd12aa" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(645..647,654..656,774..776,783..788,795..797) /gene="hoxd12a" /gene_...
Synonym: hoxd12; hoxd12aa
NM_001139551.1 - Salmo salar (Atlantic salmon) - NCBI
Hydra vulgaris homeobox protein Hox-C6a-like (LOC100215022), mRNA. (991 bp)
gene="LOC100215022" /gene_synonym="Cnox-2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 991) AUTHORS Gauchat D, Mazet F, Berney C, Schummer M, Kreger S, Pawlowski J and Galliot B. TITLE Evolution of Antp-class genes and differential expression of Hydra Hox/paraHox genes in anterior patterning JOURNAL Proc Natl Acad Sci U S A 97 (9), 4493-4498 (2000) PUBMED 10781050 REFERENCE 2 (bases 1 to 991) AUTHORS Shenk MA, Bode HR and Steele RE. TITLE Expression of Cnox-2, a HOM/HOX homeobox gene in hydra, is correlated with axial pattern...
Synonym: Cnox-2
NM_001287796.1 - Hydra vulgaris (swiftwater hydra) - NCBI
Arabidopsis thaliana WUSCHEL related homeobox 5 (WOX5), mRNA. (1052 bp)
WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /note="Arabidopsis thaliana WOX5 protein mRNA" /db_xref="Araport:AT3G11260" /db_xref="GeneID:820297" /db_xref="TAIR:AT3G11260" CDS 327..875 /gene="WOX5" /locus_tag="AT3G11260" /gene_synonym="WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /inference="Similar to RNA sequence, EST:INSD:DR750862.1,INSD:DR751206.1,INSD:DR750861.1, INSD:EH977836.1" /inference="Similar to RNA sequence, mRNA:INSD:AY150812.1,INSD:AY251398.1" /note="WUSCHEL related homeobox 5 (WOX5); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356),...
Synonym: WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B
NM_111961.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Ovis aries homeobox C6 (HOXC6), mRNA. (1196 bp)
LOCUS NM_001009335 1196 bp mRNA linear MAM 17-FEB-2022 DEFINITION Ovis aries homeobox C6 (HOXC6), mRNA. ACCESSION NM_001009335 VERSION NM_001009335.1 KEYWORDS RefSeq. SOURCE Ovis aries (sheep) ORGANISM Ovis aries Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria;...HOXC6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 199..360 /gene="HOXC6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 364..471 /gene="HOXC6" /note="propagated from UniProtKB/Swiss-Prot (P49925.1);...
NM_001009335.1 - Ovis aries (sheep) - NCBI
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (892 bp)
LOCUS NM_204990 892 bp mRNA linear VRT 04-DEC-2021 DEFINITION Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. ACCESSION NM_204990 VERSION NM_204990.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from...
Synonym: CMIX
NM_204990.2 - Gallus gallus (chicken) - NCBI - UCSC
Salmo salar homeo box A9b (hoxa9b), mRNA. (925 bp)
homeo box A9b" /db_xref="GeneID:100194482" exon 1..597 /gene="hoxa9b" /inference="alignment:Splign:2.1.0" CDS 45..836 /gene="hoxa9b" /note="homeobox protein HoxA9b" /codon_start=1 /product="homeobox protein Hox-A9b" /protein_id="NP_001133044.1" /db_xref="GeneID:100194482" /translation="...gene="hoxa9b" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 642..806 /gene="hoxa9b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" misc_feature order(642..644,651..653,771..773,780..785,792..794) /gene="hoxa9b" /note="specific DNA base...
NM_001139572.1 - Salmo salar (Atlantic salmon) - NCBI
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), mRNA. (1365 bp)
. FEATURES Location/Qualifiers source 1..1365 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="1" /ecotype="Columbia" gene 1..1365 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="Encodes WOX14, a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. Functions in the shoot meristem organizing center to...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_001332460.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Macaca mulatta NK3 homeobox 1 (NKX3-1), mRNA. (1841 bp)
ct="homeobox protein Nkx-3.1" /protein_id="NP_001253152.1" /db_xref="GeneID:710591" /db_xref="VGNC:VGNC:75355" /translation="MLRATEPLPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRRGGHTDSPRRRDPEPEPEPEGGRGPAGVQNDQLSPRPRAAPEEAETLAETEPERHLGSYLLDCENTSGSLPSLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSLYNNYPYYPYLYCVGSWSPAFW" misc_feature order(407..421,425..427,476..478,494..496,533..535, 539..544,551..556,560..568,572..577) /gene="NKX3-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 413..574 /gene="NKX3-1" /note="Homeobox...
NM_001266223.1 - Macaca mulatta (Rhesus monkey) - NCBI
Salmo salar PROP paired-like homeobox 1 (prop1), mRNA. (1119 bp)
LOCUS NM_001136547 1119 bp mRNA linear VRT 12-JAN-2022 DEFINITION Salmo salar PROP paired-like homeobox 1 (prop1), mRNA. ACCESSION NM_001136547 VERSION NM_001136547.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="prop1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 191..352 /gene="prop1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(191..193,200..202,320..322,329..334,341..343) /gene="prop1" /note="specific DNA base...
NM_001136547.1 - Salmo salar (Atlantic salmon) - NCBI
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (866 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..866 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="1" /ecotype="Columbia" gene <1..866 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="Encodes WOX14, a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. Functions in the shoot meristem organizing center to...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_001332461.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/homeobox
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.222 | 0.222 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.394 | 0.172 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.401 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]