GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-07-19 07:02:21, GGRNA : RefSeq release 88 (May, 2018)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 01-APR-2018 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1;...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Strongyloides ratti Homeobox domain and Homeobox KN domain and Homeodomain-like-containing protein (SRAE_2000258700), partial mRNA. (1398 bp)
LOCUS XM_024653672 1398 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Homeobox domain and Homeobox KN domain and Homeodomain-like-containing protein (SRAE_2000258700), partial mRNA. ACCESSION XM_024653672 VERSION XM_024653672.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is...
XM_024653672.1 - Strongyloides ratti - NCBI
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..379 /gene="MSX2" /inference="alignment:Splign:2.1.0" exon 380..804 /gene="MSX2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Mus musculus homeobox B3 and homeobox B2, opposite strand (Hoxb3os), long non-coding RNA. (685 bp)
LOCUS NR_155303 685 bp RNA linear ROD 15-APR-2018 DEFINITION Mus musculus homeobox B3 and homeobox B2, opposite strand (Hoxb3os), long non-coding RNA. ACCESSION NR_155303 VERSION NR_155303.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL606824.13. Sequence Note:...
Synonym: Gm11530; Hoxb3s
NR_155303.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus msh homeobox 1 (MSX1), mRNA. (1312 bp)
LOCUS NM_205488 1312 bp mRNA linear VRT 29-APR-2018 DEFINITION Gallus gallus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_205488 XM_444660 VERSION NM_205488.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 569..730 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(569..571,578..580,698..700,707..712,719..721) /gene="MSX1" /gene_synonym...
Synonym: CHOX-7; GHOX-7; HOX-7
NM_205488.2 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D12 (HOXD12), mRNA. (1419 bp)
LOCUS NM_205249 1419 bp mRNA linear VRT 01-APR-2018 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 676..837 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(676..678,685..687,805..807,814..819,826..828) /gene="HOXD12" /note="specific DNA base...
NM_205249.1 - Gallus gallus (chicken) - NCBI - UCSC
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Gallus gallus homeobox D8 (HOXD8), mRNA. (1263 bp)
HOXD8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 460..618 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 289..436 /gene="HOXD8" /inference="alignment:Splign:2.1.0" exon 437..1250 /gene="HOXD8" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1263) AUTHORS Crompton MR, MacGregor AD and Goodwin GH. TITLE cDNA cloning of a homeobox-containing gene expressed in avian myeloblastic virus-transformed chicken monoblastic leukaemia cells JOURNAL Leukemia...
NM_207177.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus homeobox D13 (HOXD13), mRNA. (1964 bp)
LOCUS NM_205434 1964 bp mRNA linear VRT 01-APR-2018 DEFINITION Gallus gallus homeobox D13 (HOXD13), mRNA. ACCESSION NM_205434 XM_429309 VERSION NM_205434.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 719..880 /gene="HOXD13" /gene_synonym="chox-4.8; chox-4G" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(719..721,728..730,848..850,857..862,869..871) /gene="HOXD13" /gene_...
Synonym: chox-4.8; chox-4G
NM_205434.1 - Gallus gallus (chicken) - NCBI - UCSC
Pan troglodytes HESX homeobox 1 (HESX1), mRNA. (558 bp)
codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_001075039.1" /db_xref="GeneID:747229" /db_xref="VGNC:VGNC:1836" /translation="MSPSLQEGAQLGESKPSTCSFSIERILGLDQNKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERALKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE" misc_feature order(325..339,343..345,394..396,412..414,451..453, 457..462,469..474,478..486,490..495) /gene="HESX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 331..492 /gene="HESX1" /note="Homeobox domain; Region: Homeobox...
NM_001081570.1 - Pan troglodytes (chimpanzee) - NCBI
Bos taurus retina and anterior neural fold homeobox 2 (RAX2), mRNA. (1828 bp)
gene="RAX2" /gene_synonym="QRX" /note="Region: homeobox domain" misc_feature order(130..144,148..150,199..201,217..219,256..258, 262..267,274..279,283..291,295..300) /gene="RAX2" /gene_synonym="QRX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(136..138,145..147,265..267,274..279,286..288) /gene="RAX2" /gene_synonym="QRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 139..297 /gene="RAX2" /gene_synonym="QRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon...
Synonym: QRX
NM_182653.1 - Bos taurus (cattle) - NCBI
Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. (555 bp)
LOCUS NM_001081487 555 bp mRNA linear PRI 08-APR-2018 DEFINITION Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. ACCESSION NM_001081487 XM_001136381 XM_524055 VERSION NM_001081487.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 91..249 /gene="RAX2" /gene_synonym="RAXL1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" exon 1..216 /gene="RAX2" /gene_synonym="RAXL1" /inference="alignment:Splign:2.1.0" exon...
Synonym: RAXL1
NM_001081487.1 - Pan troglodytes (chimpanzee) - NCBI
Gallus gallus caudal type homeobox 4 (CDX4), mRNA. (1453 bp)
LOCUS NM_204614 1453 bp mRNA linear VRT 01-APR-2018 DEFINITION Gallus gallus caudal type homeobox 4 (CDX4), mRNA. ACCESSION NM_204614 VERSION NM_204614.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...; other site" /db_xref="CDD:238039" misc_feature 550..708 /gene="CDX4" /gene_synonym="CDXB; CHOX-CAD2; ox-cad2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 524..669 /gene="CDX4" /gene_synonym="CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:...
Synonym: CDXB; CHOX-CAD2; ox-cad2
NM_204614.1 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus tropicalis H6 family homeobox 3 (hmx3), mRNA. (2200 bp)
LOCUS NM_001079361 2200 bp mRNA linear VRT 01-APR-2018 DEFINITION Xenopus tropicalis H6 family homeobox 3 (hmx3), mRNA. ACCESSION NM_001079361 VERSION NM_001079361.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 763..924 /gene="hmx3" /gene_synonym="nkx-5.1; nkx5-1; nkx5.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(763..765,772..774,892..894,901..906,913..915) /gene="hmx3" /gene_...
Synonym: nkx-5.1; nkx5-1; nkx5.1
NM_001079361.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. (1821 bp)
LOCUS NM_001165009 1821 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. ACCESSION NM_001165009 VERSION NM_001165009.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="drgx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..692 /gene="drgx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001165009.1 - Saccoglossus kowalevskii - NCBI
Gallus gallus homeobox A6 (HOXA6), mRNA. (1467 bp)
LOCUS NM_001030987 1467 bp mRNA linear VRT 30-APR-2018 DEFINITION Gallus gallus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001030987 XM_418729 VERSION NM_001030987.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 469..627 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..436 /gene="HOXA6" /gene_synonym="HOX1; HOX1.2; HOX1B" /inference="alignment:...
Synonym: HOX1; HOX1.2; HOX1B
NM_001030987.2 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-3.S), mRNA. (742 bp)
zax; zax-A" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(374..376,383..385,503..505,512..517,524..526) /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 309..742 /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 742) AUTHORS Newman CS and Krieg PA. TITLE The Xenopus bagpipe-related homeobox gene zampogna is expressed in the...
Synonym: bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A
NM_001085685.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis VENT homeobox 3, gene 2 S homeolog (ventx3.2.S), mRNA. (1072 bp)
LOCUS NM_001088485 1072 bp mRNA linear VRT 01-APR-2018 DEFINITION Xenopus laevis VENT homeobox 3, gene 2 S homeolog (ventx3.2.S), mRNA. ACCESSION NM_001088485 NM_001088486 VERSION NM_001088485.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa;...; other site" /db_xref="CDD:238039" misc_feature 448..606 /gene="ventx3.2.S" /gene_synonym="ventx3.2; vex1; xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 308..567 /gene="ventx3.2.S" /gene_synonym="ventx3.2; vex1; xvex-1" /inference="...
Synonym: ventx3.2; vex1; xvex-1
NM_001088485.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus homeobox A6 (Hoxa6), mRNA. (932 bp)
LOCUS NM_010454 932 bp mRNA linear ROD 29-MAR-2018 DEFINITION Mus musculus homeobox A6 (Hoxa6), mRNA. ACCESSION NM_010454 VERSION NM_010454.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 570..728 /gene="Hoxa6" /gene_synonym="Hox-1.2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 538..932 /gene="Hoxa6" /gene_synonym="Hox-1.2" /inference="alignment:Splign:2.1.0"...
Synonym: Hox-1.2
NM_010454.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus mesenchyme homeobox 2 (Meox2), mRNA. (2244 bp)
LOCUS NM_017149 2244 bp mRNA linear ROD 08-APR-2018 DEFINITION Rattus norvegicus mesenchyme homeobox 2 (Meox2), mRNA. ACCESSION NM_017149 VERSION NM_017149.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...Meox2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 764..922 /gene="Meox2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 711..883 /gene="Meox2" /inference="alignment:Splign:2.1.0" exon 884..2244 /gene="...
NM_017149.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Pan troglodytes homeobox D4 (HOXD4), mRNA. (768 bp)
LOCUS NM_001081569 768 bp mRNA linear PRI 29-APR-2018 DEFINITION Pan troglodytes homeobox D4 (HOXD4), mRNA. ACCESSION NM_001081569 XM_001153123 VERSION NM_001081569.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="HOXD4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 469..630 /gene="HOXD4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(469..471,478..480,598..600,607..612,619..621) /gene="HOXD4" /note="specific DNA base...
NM_001081569.1 - Pan troglodytes (chimpanzee) - NCBI
Rattus norvegicus homeobox C8 (Hoxc8), mRNA. (1228 bp)
FEATURES Location/Qualifiers source 1..1228 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..1228 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox C8" /db_xref="GeneID:24460" /db_xref="RGD:2821" CDS 1..729 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox protein R4; Homeobox gene C8; homeo box C8" /codon_start=1 /product="homeobox protein Hox-C8" /protein_id="NP_001170797.2" /db_xref="GeneID:24460" /db_xref="RGD:2821" /translation="...
Synonym: Hox3r4
NM_001177326.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 8..75 /gene="HOXA6" /standard_name="Hoxa6" /db_xref="UniSTS:536644" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Glycine max homeobox protein SBH1 (H1), mRNA. (1515 bp)
xref="CDD:281743" misc_feature 1056..1175 /gene="H1" /gene_synonym="Sbh1" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" exon 594..849 /gene="H1" /gene_synonym="Sbh1" /inference="alignment:Splign:2.1.0" exon 850..1091 /gene="H1" /gene_synonym="Sbh1" /inference="alignment:Splign:2.1.0" exon 1092..1515 /gene="H1" /gene_synonym="Sbh1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1515) AUTHORS Ma H, McMullen MD and Finer JJ. TITLE Identification of a homeobox-containing gene with enhanced expression during soybean (Glycine max L.) somatic...
Synonym: Sbh1
NM_001251129.1 - Glycine max (soybean) - NCBI
Pan troglodytes homeobox D8 (HOXD8), mRNA. (873 bp)
gene="HOXD8" /note="homeobox D8" /db_xref="GeneID:459763" /db_xref="VGNC:VGNC:1967" CDS 1..873 /gene="HOXD8" /codon_start=1 /product="homeobox protein Hox-D8" /protein_id="NP_001074950.1" /db_xref="GeneID:459763" /db_xref="VGNC:VGNC:1967" /translation="MSSYFVNPLYSKYKGEAINPTYYDCHFVPEVGGRHLQLYGNSAAGFPHAPPQAHAHPHPSPPPSGTGCGGRDGRGQEYFHPGGGSPAAAYQAAHCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN" misc_feature 421..>774 /gene="HOXD8" /note="Homeobox protein; Region: Abdominal-A;...
NM_001081481.1 - Pan troglodytes (chimpanzee) - NCBI
Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. (1845 bp)
LOCUS NM_205252 1845 bp mRNA linear VRT 01-APR-2018 DEFINITION Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. ACCESSION NM_205252 VERSION NM_205252.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..686 /gene="HHEX" /gene_synonym="PROBOX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 469..647 /gene="HHEX" /gene_synonym="PROBOX" /inference="alignment:Splign:2.1.0" exon...
Synonym: PROBOX
NM_205252.1 - Gallus gallus (chicken) - NCBI - UCSC
Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. (1144 bp)
LOCUS NM_010420 1144 bp mRNA linear ROD 13-MAY-2018 DEFINITION Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. ACCESSION NM_010420 VERSION NM_010420.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...Rpx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 689..850 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(689..691,698..700,818..820,827..832,839..841) /gene="Hesx1" /gene_...
Synonym: HES-1; Rpx
NM_010420.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box B8 (Hoxb8), mRNA. (973 bp)
The reference sequence was derived from AABR07030395.1. On Jul 17, 2010 this sequence version replaced XM_220888.4. Summary: mouse homolog is a homeobox transcription factor; involved in control of developmental pathways [RGD, Feb 2006]. Sequence Note: The RefSeq transcript and protein were derived...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 448..606 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" exon 1..424 /gene="Hoxb8" /gene_synonym="Hox2r1a" /inference="alignment:Splign:2.1.0" STS...
Synonym: Hox2r1a
NM_001191649.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Pan troglodytes homeobox B1 (HOXB1), mRNA. (906 bp)
LOCUS NM_001081572 906 bp mRNA linear PRI 01-APR-2018 DEFINITION Pan troglodytes homeobox B1 (HOXB1), mRNA. ACCESSION NM_001081572 XM_001173083 VERSION NM_001081572.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="HOXB1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 619..777 /gene="HOXB1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(625..627,745..747,754..759,766..768) /gene="HOXB1" /note="specific DNA base contacts...
NM_001081572.1 - Pan troglodytes (chimpanzee) - NCBI
Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. (1036 bp)
LOCUS NM_001129916 1036 bp mRNA linear VRT 01-APR-2018 DEFINITION Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. ACCESSION NM_001129916 VERSION NM_001129916.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 427..585 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 296..546 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /inference="alignment:...
Synonym: vex1; Xvex-1
NM_001129916.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. (2158 bp)
LOCUS NM_001164939 2158 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. ACCESSION NM_001164939 VERSION NM_001164939.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 487..645 /gene="hox6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2158) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164939.1 - Saccoglossus kowalevskii - NCBI
Bos taurus paired related homeobox 1 (PRRX1), mRNA. (1001 bp)
CDS 246..983 /gene="PRRX1" /note="paired mesoderm homeobox 1" /codon_start=1 /product="paired mesoderm homeobox protein 1" /protein_id="NP_001075208.1" /db_xref="BGD:BT11112" /db_xref="GeneID:540901" /db_xref="VGNC:VGNC:33412" /translation="MTSSYGHVLERQPALGGRLDSPSNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCANNNPAQGINMANSIANLRLKAKEYSLQRNQVPTVN" misc_feature 540..695 /gene="PRRX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475"...
NM_001081739.1 - Bos taurus (cattle) - NCBI
Bos taurus BARX homeobox 2 (BARX2), mRNA. (1836 bp)
LOCUS NM_001101266 1836 bp mRNA linear MAM 14-MAY-2018 DEFINITION Bos taurus BARX homeobox 2 (BARX2), mRNA. ACCESSION NM_001101266 XM_869733 VERSION NM_001101266.1 KEYWORDS RefSeq. SOURCE Bos taurus (cattle) ORGANISM Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="BARX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 677..838 /gene="BARX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(677..679,686..688,806..808,815..820,827..829) /gene="BARX2" /note="specific DNA base...
NM_001101266.1 - Bos taurus (cattle) - NCBI
Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. (1822 bp)
LOCUS NM_001164980 1822 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. ACCESSION NM_001164980 VERSION NM_001164980.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 355..474 /gene="tgif1" /gene_synonym="tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 1822) AUTHORS Freeman,R.M. Jr., Wu,M., Cordonnier-...
Synonym: tgif
NM_001164980.1 - Saccoglossus kowalevskii - NCBI
PREDICTED: Homo sapiens Meis homeobox 3 (MEIS3), transcript variant X8, mRNA. (2165 bp)
gene_synonym="MRG2" /codon_start=1 /product="homeobox protein Meis3 isoform X8" /protein_id="XP_024307385.1" /db_xref="GeneID:56917" /db_xref="HGNC:HGNC:29537" /translation="MIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL" misc_feature <849..989 /gene="MEIS3" /gene_synonym="MRG2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N;...
Synonym: MRG2
XM_024451617.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-2.S), mRNA. (990 bp)
LOCUS NM_001085813 990 bp mRNA linear VRT 01-APR-2018 DEFINITION Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-2.S), mRNA. ACCESSION NM_001085813 VERSION NM_001085813.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata;..." /db_xref="CDD:238039" misc_feature 613..774 /gene="nkx3-2.S" /gene_synonym="bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(613..615,622..624,742..744,751..756,763..765) /gene="nkx3-2.S" /gene_...
Synonym: bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap
NM_001085813.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus homeobox D8 (Hoxd8), transcript variant 3, mRNA. (1683 bp)
LOCUS NM_001290731 1683 bp mRNA linear ROD 05-APR-2018 DEFINITION Mus musculus homeobox D8 (Hoxd8), transcript variant 3, mRNA. ACCESSION NM_001290731 VERSION NM_001290731.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...; other site" /db_xref="CDD:238039" misc_feature 282..440 /gene="Hoxd8" /gene_synonym="4921540P06Rik; AI047735; Hox-4.3; Hox-5.4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 259..1678 /gene="Hoxd8" /gene_synonym="4921540P06Rik; AI047735; Hox-4.3; Hox...
Synonym: 4921540P06Rik; AI047735; Hox-4.3; Hox-5.4
NM_001290731.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus BARX homeobox 1 (BARX1), mRNA. (1170 bp)
LOCUS NM_204193 1170 bp mRNA linear VRT 08-APR-2018 DEFINITION Gallus gallus BARX homeobox 1 (BARX1), mRNA. ACCESSION NM_204193 VERSION NM_204193.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...BARX1B" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 465..626 /gene="BARX1" /gene_synonym="BARX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(465..467,474..476,594..596,603..608,615..617) /gene="BARX1" /gene_...
Synonym: BARX1B
NM_204193.1 - Gallus gallus (chicken) - NCBI - UCSC
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 KEYWORDS RefSeq. SOURCE Takifugu rubripes (Fugu rubripes) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata; Craniata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (Fugu rubripes) - NCBI
Bos taurus msh homeobox 1 (MSX1), mRNA. (1895 bp)
LOCUS NM_174798 1895 bp mRNA linear MAM 14-MAY-2018 DEFINITION Bos taurus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_174798 VERSION NM_174798.2 KEYWORDS RefSeq. SOURCE Bos taurus (cattle) ORGANISM Bos taurus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria;...gene="MSX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 745..906 /gene="MSX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(745..747,754..756,874..876,883..888,895..897) /gene="MSX1" /note="specific DNA base...
NM_174798.2 - Bos taurus (cattle) - NCBI
Bos taurus distal-less homeobox 3 (DLX3), mRNA. (2608 bp)
frame stop codon" CDS 210..1073 /gene="DLX3" /codon_start=1 /product="homeobox protein DLX-3" /protein_id="NP_001075091.1" /db_xref="BGD:BT18274" /db_xref="GeneID:784366" /translation="MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLGGTGAYSPKSEYTYGTSYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY" misc_feature 288..530 /gene="DLX3" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001081622.1 - Bos taurus (cattle) - NCBI
PREDICTED: Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant X16, mRNA. (3165 bp)
start=1 /product="homeobox protein PKNOX2 isoform X5" /protein_id="XP_024304419.1" /db_xref="GeneID:63876" /db_xref="HGNC:HGNC:16714" /db_xref="MIM:613066" /translation="MTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMHSDNLLRNDLGGPYSPNQPSINLHSQHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLSSDSATMAMQQAMMAAHDDSLDGTEEEDEDEMLEEEVDELQTTNVSDLGLEHSDSLE" misc_feature 383..634 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1;...
Synonym: PREP2
XM_024448651.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens PBX/knotted 1 homeobox 2 (PKNOX2), transcript variant X15, mRNA. (3245 bp)
start=1 /product="homeobox protein PKNOX2 isoform X5" /protein_id="XP_024304418.1" /db_xref="GeneID:63876" /db_xref="HGNC:HGNC:16714" /db_xref="MIM:613066" /translation="MTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMHSDNLLRNDLGGPYSPNQPSINLHSQHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLSSDSATMAMQQAMMAAHDDSLDGTEEEDEDEMLEEEVDELQTTNVSDLGLEHSDSLE" misc_feature 463..714 /gene="PKNOX2" /gene_synonym="PREP2" /note="N-terminal of Homeobox Meis and PKNOX1;...
Synonym: PREP2
XM_024448650.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Mus musculus GS homeobox 2 (Gsx2), mRNA. (1665 bp)
LOCUS NM_133256 1665 bp mRNA linear ROD 13-MAY-2018 DEFINITION Mus musculus GS homeobox 2 (Gsx2), mRNA. ACCESSION NM_133256 VERSION NM_133256.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 779..937 /gene="Gsx2" /gene_synonym="Gsh-2; Gsh2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 702..776 /gene="Gsx2" /gene_synonym="Gsh-2; Gsh2" /standard_name="Gsx2" /db_xref="...
Synonym: Gsh-2; Gsh2
NM_133256.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens Meis homeobox 3 (MEIS3), transcript variant X7, mRNA. (1762 bp)
LOCUS XM_024451616 1762 bp mRNA linear PRI 26-MAR-2018 DEFINITION PREDICTED: Homo sapiens Meis homeobox 3 (MEIS3), transcript variant X7, mRNA. ACCESSION XM_024451616 VERSION XM_024451616.1 DBLINK BioProject: PRJNA168 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota;...misc_feature 386..586 /gene="MEIS3" /gene_synonym="MRG2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:318653" misc_feature 1034..1144 /gene="MEIS3" /gene_synonym="MRG2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:310480"...
Synonym: MRG2
XM_024451616.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Bos taurus hematopoietically expressed homeobox (HHEX), mRNA. (1741 bp)
gene="HHEX" /codon_start=1 /product="hematopoietically-expressed homeobox protein HHEX" /protein_id="NP_001098894.1" /db_xref="BGD:BT21198" /db_xref="GeneID:539542" /db_xref="VGNC:VGNC:29839" /translation="MQYPHPGPATAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPTPTLPSPNSSFTSLVSSYRAPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRSVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQNNKKEELESLDNSCDQRQDLPSDQNTGALESSQCSPSPVSQEDLESEISEDSDQEVDIEGDKGYFNAG" misc_feature <435..743 /gene="HHEX" /note="Homeobox protein; Region: Abdominal-A; cl27820" /db_xref="CDD:332641" misc_...
NM_001105424.1 - Bos taurus (cattle) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/homeobox
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.405 | 0.405 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.788 | 0.383 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.794 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]