GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2020-06-02 17:12:23, GGRNA : RefSeq release 200 (May, 2020)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 27-APR-2020 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1;...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
PREDICTED: Xenopus tropicalis pituitary homeobox 3-like [provisional] (homeobox100496651-provisional), mRNA. (1234 bp)
LOCUS XM_002941764 1234 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis pituitary homeobox 3-like [provisional] (homeobox100496651-provisional), mRNA. ACCESSION XM_002941764 VERSION XM_002941764.5 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_002941764.5 - Xenopus tropicalis (tropical clawed frog) - NCBI
Strongylocentrotus purpuratus homeobox (H-6 family) (HMX), mRNA. (1402 bp)
misc_feature order(881..895,899..901,950..952,968..970,1007..1009, 1013..1018,1025..1030,1034..1042,1046..1051) /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 887..1048 /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(887..889,896..898,1016..1018,1025..1030,1037..1039) /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1...
Synonym: homeobox; SpHmx
NM_214561.2 - Strongylocentrotus purpuratus (purple sea urchin) - NCBI
Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 04-AUG-2019 DEFINITION Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript...
Synonym: GRMZM2G136369; homeobox1; hox1a; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Gallus gallus homeobox D8 (HOXD8), mRNA. (1263 bp)
order(457..459,466..468,586..588,595..600,607..609) /gene="HOXD8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 460..618 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1263) AUTHORS Crompton MR, MacGregor AD and Goodwin GH. TITLE cDNA cloning of a homeobox-containing gene expressed in avian myeloblastic virus-transformed chicken monoblastic leukaemia cells JOURNAL Leukemia 5 (5), 357-360 (1991) PUBMED 1674560...
NM_207177.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Homo sapiens leucine twenty homeobox (LEUTX), transcript variant 2, mRNA. (969 bp)
homeobox-like pseudogene; PRD-LIKE homeobox transcription factor LEUTX; paired-like homeobox transcription factor LEUTX; paired-like homeodomain transcription factor LEUTX" /codon_start=1 /product="paired-like homeodomain transcription factor LEUTX isoform 2" /protein_id="NP_001137304.1" /db_xref="GeneID:342900" /db_xref="HGNC:HGNC:31953" /db_xref="MIM:618701" /translation="MHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYDLPGEDDTSSLNQYLFPVCLEYDQLQSSV" misc_feature <307..408 /gene="LEUTX" /note="Homeobox...
NM_001143832.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
sequence (NC_003071). FEATURES Location/Qualifiers source 1..1963 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene 1..1963 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Encodes a protein with similarity to WUS type homeodomain protein. Required for meristem growth and development and acts through positive regulation of WUS. Loss of function phenotypes include embryo lethality, hyponastic cotyledons, reduced...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Fundulus heteroclitus homeobox A2b (hoxa2b), mRNA. (1318 bp)
SAMN03775336 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1318 /organism="Fundulus heteroclitus" /mol_type="mRNA" /db_xref="taxon:8078" gene 1..1318 /gene="hoxa2b" /gene_synonym="Hoxa2x" /note="homeobox A2b" /db_xref="GeneID:105926292" CDS 121..1110 /gene="hoxa2b" /gene_synonym="Hoxa2x" /note="homeobox A2x; Hox A2b; Homeobox protein Hox-A2" /codon_start=1 /product="homeobox protein Hox-A2b" /protein_id="NP_001296907.1" /db_xref="GeneID:105926292" /translation="...
Synonym: Hoxa2x
NM_001309978.1 - Fundulus heteroclitus (mummichog) - NCBI
Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. (894 bp)
LOCUS NM_205015 894 bp mRNA linear VRT 28-APR-2020 DEFINITION Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. ACCESSION NM_205015 XM_429269 VERSION NM_205015.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...TLX-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 511..672 /gene="TLX1" /gene_synonym="TLX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(511..513,520..522,640..642,649..654,661..663) /gene="TLX1" /gene_synonym="...
Synonym: TLX-1
NM_205015.1 - Gallus gallus (chicken) - NCBI - UCSC
Ovis aries homeobox C6 (HOXC6), mRNA. (1196 bp)
LOCUS NM_001009335 1196 bp mRNA linear MAM 28-APR-2020 DEFINITION Ovis aries homeobox C6 (HOXC6), mRNA. ACCESSION NM_001009335 VERSION NM_001009335.1 KEYWORDS RefSeq. SOURCE Ovis aries (sheep) ORGANISM Ovis aries Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria;...HOXC6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 199..360 /gene="HOXC6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:333795" ORIGIN //...
NM_001009335.1 - Ovis aries (sheep) - NCBI
Arabidopsis thaliana homeobox 53 (HB53), mRNA. (941 bp)
NA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox,...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9
NM_126068.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-3.S), mRNA. (742 bp)
gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(374..376,383..385,503..505,512..517,524..526) /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 742) AUTHORS Newman CS and Krieg PA. TITLE The Xenopus bagpipe-related homeobox gene zampogna is expressed in the pharyngeal endoderm and the visceral musculature of the midgut...
Synonym: bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A
NM_001085685.1 - Xenopus laevis (African clawed frog) - NCBI
Salmo salar distal-less homeobox 5a (dlx5a), mRNA. (1115 bp)
synonym="dlx5" /note="distal-less homeobox gene 5a; distal-less homeobox 5" /codon_start=1 /product="homeobox protein Dlx5a" /protein_id="NP_001134142.1" /db_xref="GeneID:100195641" /translation="MTGVFDRRIPSIKPADFQNPFQLSTTMHHPSQESPTLPESTATDSGYYSPAGAVHHGYCSPNSTSYGKPINAYQYQYHGVNGSAGNYPAKTYPDYSAYTASAYHQYAGTYSRVQPQPLSPQEKEVAEPEVRMVNGKPKKIRKPRTIYSSFQLAALQRRFQNTQYLALPERAELAASLGLTQTQVKIWFQNKRSKLKKIMKNGELPPEHSPSSSDPMACNSPHSPAVWDTQGPSRPHSHQAQNNNSAASTFLENSASWYSAAGAMNSHLQAPNSIQHSLVLGSGTLY" misc_feature 188..454 /gene="dlx5a" /gene_synonym="dlx5" /note="Homeobox protein distal-less-like N terminal; Region...
Synonym: dlx5
NM_001140670.1 - Salmo salar (Atlantic salmon) - NCBI
Arabidopsis thaliana homeobox 3 (HB-3), mRNA. (1564 bp)
; HOMEOBOX PROTEIN" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 875..991 /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="Homeobox...
Synonym: ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN
NM_121519.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus caudal type homeobox 4 (CDX4), mRNA. (1453 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 524..669 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" exon 670..1445 /gene="CDX4" /gene_synonym="cCdx-B; CDXB; CHOX-CAD2; ox-cad2" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1453) AUTHORS Joshi P, Darr AJ and Skromne I. TITLE CDX4 regulates the progression of neural maturation in the spinal cord JOURNAL Dev. Biol. 449 (2), 132-142 (2019) PUBMED 30825428 REMARK GeneRIF: Results show that in the spinal cord, caudal type homeobox 4 (CDX4)...
Synonym: cCdx-B; CDXB; CHOX-CAD2; ox-cad2
NM_204614.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus sensory organ homeobox (SOHO1), mRNA. (1820 bp)
gene="SOHO1" /gene_synonym="SOHO-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(423..425,432..434,552..554,561..566,573..575) /gene="SOHO1" /gene_synonym="SOHO-1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 250..1805 /gene="SOHO1" /gene_synonym="SOHO-1" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1820) AUTHORS Deitcher DL, Fekete DM and Cepko CL. TITLE Asymmetric expression of a novel homeobox gene in vertebrate sensory organs JOURNAL J. Neurosci...
Synonym: SOHO-1
NM_205386.1 - Gallus gallus (chicken) - NCBI - UCSC
Salmo salar PROP paired-like homeobox 1 (prop1), mRNA. (1119 bp)
misc_feature 191..352 /gene="prop1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(191..193,200..202,320..322,329..334,341..343) /gene="prop1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 96..319 /gene="prop1" /inference="alignment:Splign:2.0.8" exon 320..1095 /gene="prop1" /inference="alignment:Splign:2.0.8" ORIGIN // REFERENCE 1 (bases 1 to 1119) AUTHORS Angotzi AR, Mungpakdee S, Stefansson S, Male R and Chourrout D. TITLE Involvement of Prop1 homeobox gene in the early development of fish...
NM_001136547.1 - Salmo salar (Atlantic salmon) - NCBI
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (876 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22" /inference="Similar to RNA sequence, EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1" /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1" /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22
NM_179935.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 08-OCT-2016 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AABR07030395.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Haplochromis burtoni distal-less homeobox 3b (dlx3b), mRNA. (1639 bp)
gene_synonym="dlx3" /note="distal-less homeobox protein 3b; distal-less homeobox 3" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001273244.1" /db_xref="GeneID:102307675" /translation="MSAGQTYEKKIASILTDLPGSMSCHPNSKDSPTLPESSVTDMGYYSGQTAHGHHEYYQSQPYGQPMNSYHHQFNLNGMGAAGAYATKSEYPYTNGYRQYGHYNRDHLQASPPGSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNASDSMACNSPPSPAVWDNSSTPQNTPISRPQVPQPTHSSSPPYLEDYNNHWYQQGSHLQHPGAVHHPVPQQSVGAVY" misc_feature 195..446 /gene="dlx3b" /gene_synonym="dlx3" /note="Homeobox protein distal-less-like N terminal;...
Synonym: dlx3
NM_001286315.1 - Haplochromis burtoni (Burton's mouthbrooder) - NCBI
Pan troglodytes homeobox D4 (HOXD4), mRNA. (768 bp)
LOCUS NM_001081569 768 bp mRNA linear PRI 27-APR-2020 DEFINITION Pan troglodytes homeobox D4 (HOXD4), mRNA. ACCESSION NM_001081569 XM_001153123 VERSION NM_001081569.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="HOXD4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 469..630 /gene="HOXD4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(469..471,478..480,598..600,607..612,619..621) /gene="HOXD4" /note="specific DNA base...
NM_001081569.1 - Pan troglodytes (chimpanzee) - NCBI
Mus musculus homeobox B3 and homeobox B2, opposite strand (Hoxb3os), long non-coding RNA. (685 bp)
LOCUS NR_155303 685 bp RNA linear ROD 31-MAR-2020 DEFINITION Mus musculus homeobox B3 and homeobox B2, opposite strand (Hoxb3os), long non-coding RNA. ACCESSION NR_155303 VERSION NR_155303.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL606824.13. Sequence Note:...
Synonym: Gm11530; Hoxb3s
NR_155303.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Pan troglodytes homeobox B1 (HOXB1), mRNA. (906 bp)
LOCUS NM_001081572 906 bp mRNA linear PRI 27-APR-2020 DEFINITION Pan troglodytes homeobox B1 (HOXB1), mRNA. ACCESSION NM_001081572 XM_001173083 VERSION NM_001081572.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="HOXB1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 619..777 /gene="HOXB1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(625..627,745..747,754..759,766..768) /gene="HOXB1" /note="specific DNA base contacts...
NM_001081572.1 - Pan troglodytes (chimpanzee) - NCBI
Haplochromis burtoni distal-less homeobox 2a (dlx2a), mRNA. (1121 bp)
gene_synonym="dlx2" /note="distal-less homeobox protein 2a; distal-less homeobox 2" /codon_start=1 /product="homeobox protein Dlx2a" /protein_id="NP_001273261.1" /db_xref="GeneID:102296559" /translation="MTGVFENLNTDMHSNQITSSNYHSLHKSQESPTLPVSTATDSSYYNGQQPGHCAGSPFGQLGTYQYHSSATSSVPYNAKSYDLGFNSSYGTYGSYGSNSSPTPADTEKDESEPEIRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLWKSGEIPPEQHVASSESPPCTSPPTTAWDFPQTQRMNNVSSSLPQSSSPPNTTAPSSFLANYSWYSTTNSTTHLQPPLVQHHHNSAISAGTIF" misc_feature 296..526 /gene="dlx2a" /gene_synonym="dlx2" /note="Homeobox protein distal-less-like N terminal; Region:...
Synonym: dlx2
NM_001286332.1 - Haplochromis burtoni (Burton's mouthbrooder) - NCBI
Haplochromis burtoni distal-less homeobox 5a (dlx5a), mRNA. (1269 bp)
synonym="dlx5" /note="distal-less homeobox protein 5a; distal-less homeobox 5" /codon_start=1 /product="homeobox protein Dlx5a" /protein_id="NP_001273250.1" /db_xref="GeneID:102296998" /translation="MTGVFDRRIPSVKSADFESSFQLSSMHHPSQESPTLPESSATDSGYYSPAGGVAHGYCSPSSTSYGKPLNAYQYQYPGVNGSAGNYSTKSYTDYSSYTTPSYHQYAGTYSRVQAQPSPQEKEISEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQNTQYLALPERAELAASLGLTQTQVKIWFQNRRSKMKKIMKNGELPPEHSPSSSDPMACNSPQSPAVWDTQGPSRPHSLQPQSINTTASNFLENTGSWYTSAGSSMTSHLQTPNSIQHSLALGAGTLY" misc_feature 264..530 /gene="dlx5a" /gene_synonym="dlx5" /note="Homeobox protein distal-less-like N terminal;...
Synonym: dlx5
NM_001286321.1 - Haplochromis burtoni (Burton's mouthbrooder) - NCBI
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Rattus norvegicus homeo box A2 (Hoxa2), mRNA. (1634 bp)
Hoxa-2; Hoxa11; RATHOX111A" /inference="alignment:Splign:2.0.8" misc_feature 53..55 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; RATHOX111A" /note="upstream in-frame stop codon" CDS 158..1276 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; RATHOX111A" /note="Homeobox gene A11; Homeobox gene A2; homeobox protein Hox-1.11" /codon_start=1 /product="homeobox protein Hox-A2" /protein_id="NP_036713.2" /db_xref="GeneID:103690123" /db_xref="RGD:2813" /translation="...
Synonym: hox-1.11; Hoxa-2; Hoxa11; RATHOX111A
NM_012581.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Oryzias latipes homeobox D9a (hoxd9a), mRNA. (923 bp)
LOCUS NM_001201491 923 bp mRNA linear VRT 12-APR-2020 DEFINITION Oryzias latipes homeobox D9a (hoxd9a), mRNA. ACCESSION NM_001201491 VERSION NM_001201491.1 KEYWORDS RefSeq. SOURCE Oryzias latipes (Japanese medaka) ORGANISM Oryzias latipes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...hoxd9" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 638..799 /gene="hoxd9a" /gene_synonym="hoxd9" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(638..640,647..649,767..769,776..781,788..790) /gene="hoxd9a" /gene_...
Synonym: hoxd9
NM_001201491.1 - Oryzias latipes (Japanese medaka) - NCBI
Mus musculus TGFB-induced factor homeobox 2-like, X-linked 2 (Tgif2lx2), mRNA. (1032 bp)
CDS 116..811 /gene="Tgif2lx2" /codon_start=1 /product="TGFB-induced factor homeobox 2-like, X-linked 2" /protein_id="NP_001136222.1" /db_xref="CCDS:CCDS53177.1" /db_xref="GeneID:100039551" /db_xref="MGI:MGI:3800824" /translation="MEEAEGSPEETQDFMKYYSSFGIRLERTCKMKFHDSRELPRGNMLPLKSVKILRDWLCEHQFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHLRWEIRYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNIEKEEKISITEPWSSPEVAWPEEKPDFSSFYMLVDVAVQKAKEMEEQKKQNPNPQGPQQQFM" misc_feature 281..397 /gene="Tgif2lx2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN //...
NM_001142750.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Oryzias latipes distal-less homeobox 2a (dlx2a), mRNA. (1648 bp)
less homeobox 2a" /db_xref="GeneID:100049449" CDS 158..991 /gene="dlx2a" /gene_synonym="dlx2" /note="distal-less homeobox 2" /codon_start=1 /product="homeobox protein Dlx2a" /protein_id="NP_001098290.1" /db_xref="GeneID:100049449" /translation="MTGVFENLNTDMHSNQITSNSYHSLHKSQESPTLPVSTATDSSYYNGPQPGHCTGTPFGQLGSYQYHSNATGSVPYNAKTYELGFNSSYGAYSSYGSTNSPTPPADNEKEESEPEIRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKQWKSGEIPPEQHVAASESPPCTSPPTTAWDFPQTQRMNSISSSLPQSISPPNTTAPSSFLTNYSWYSTTNSTTHLQSPLVQHHHGSAISAGTIF" misc_feature 242..469 /gene="dlx2a" /gene_synonym="dlx2" /note="Homeobox...
Synonym: dlx2
NM_001104820.1 - Oryzias latipes (Japanese medaka) - NCBI
Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. (1144 bp)
LOCUS NM_010420 1144 bp mRNA linear ROD 29-MAR-2020 DEFINITION Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. ACCESSION NM_010420 VERSION NM_010420.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata;...Rpx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 689..850 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(689..691,698..700,818..820,827..832,839..841) /gene="Hesx1" /gene_...
Synonym: HES-1; Rpx
NM_010420.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus msh homeobox 2 (Msx2), mRNA. (2162 bp)
LOCUS NM_013601 2162 bp mRNA linear ROD 28-APR-2020 DEFINITION Mus musculus msh homeobox 2 (Msx2), mRNA. ACCESSION NM_013601 VERSION NM_013601.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 503..664 /gene="Msx2" /gene_synonym="BB122635; Hox-8; Hox8; Hox8.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(503..505,512..514,632..634,641..646,653..655) /gene="Msx2" /gene_...
Synonym: BB122635; Hox-8; Hox8; Hox8.1
NM_013601.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-leucine zipper protein 4 (HB4), mRNA. (1394 bp)
gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 702..854 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 858..989 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8
NM_130055.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (1018 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /inference="Similar to RNA sequence, EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1, INSD:DR751539.1" /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1" /note="homeobox-leucine zipper protein 17 (HB17); FUNCTIONS IN: sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_126204.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Callorhinchus milii homeobox B8a (hoxb8a), mRNA. (1679 bp)
LOCUS NM_001292315 1679 bp mRNA linear VRT 10-APR-2020 DEFINITION Callorhinchus milii homeobox B8a (hoxb8a), mRNA. ACCESSION NM_001292315 XM_007904373 VERSION NM_001292315.1 KEYWORDS RefSeq. SOURCE Callorhinchus milii (elephant shark) ORGANISM Callorhinchus milii Eukaryota; Metazoa; Chordata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 783..941 /gene="hoxb8a" /gene_synonym="hoxb8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 760..1679 /gene="hoxb8a" /gene_synonym="hoxb8" /inference="alignment:Splign:2.1.0"...
Synonym: hoxb8
NM_001292315.1 - Callorhinchus milii (elephant shark) - NCBI
Salmo salar homeobox A4a (hoxa4a), mRNA. (955 bp)
LOCUS NM_001139569 955 bp mRNA linear VRT 10-APR-2020 DEFINITION Salmo salar homeobox A4a (hoxa4a), mRNA. ACCESSION NM_001139569 VERSION NM_001139569.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...hoxa4ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 499..660 /gene="hoxa4a" /gene_synonym="hoxa4ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(499..501,508..510,628..630,637..642,649..651) /gene="hoxa4a" /gene_...
Synonym: hoxa4ab
NM_001139569.1 - Salmo salar (Atlantic salmon) - NCBI
Salmo salar homeobox A1a (hoxa1a), mRNA. (995 bp)
LOCUS NM_001139563 995 bp mRNA linear VRT 10-APR-2020 DEFINITION Salmo salar homeobox A1a (hoxa1a), mRNA. ACCESSION NM_001139563 VERSION NM_001139563.2 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 669..827 /gene="hoxa1a" /gene_synonym="hoxa1; hoxa1aa" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(675..677,795..797,804..809,816..818) /gene="hoxa1a" /gene_synonym="...
Synonym: hoxa1; hoxa1aa
NM_001139563.2 - Salmo salar (Atlantic salmon) - NCBI
Esox lucius homeobox B7a (hoxb7a), mRNA. (1301 bp)
LOCUS NM_001310849 1301 bp mRNA linear VRT 10-APR-2020 DEFINITION Esox lucius homeobox B7a (hoxb7a), mRNA. ACCESSION NM_001310849 XM_010874647 VERSION NM_001310849.1 KEYWORDS RefSeq. SOURCE Esox lucius (northern pike) ORGANISM Esox lucius Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 493..651 /gene="hoxb7a" /gene_synonym="hoxb7; HXB7A" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 473..1301 /gene="hoxb7a" /gene_synonym="hoxb7; HXB7A" /inference="alignment:Splign...
Synonym: hoxb7; HXB7A
NM_001310849.1 - Esox lucius (northern pike) - NCBI
Haplochromis burtoni distal-less homeobox 1a (dlx1a), mRNA. (2021 bp)
LOCUS NM_001286290 2021 bp mRNA linear VRT 12-APR-2020 DEFINITION Haplochromis burtoni distal-less homeobox 1a (dlx1a), mRNA. ACCESSION NM_001286290 XM_005921507 VERSION NM_001286290.1 KEYWORDS RefSeq. SOURCE Haplochromis burtoni (Burton's mouthbrooder) ORGANISM Haplochromis burtoni Eukaryota;...dlx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 542..703 /gene="dlx1a" /gene_synonym="dlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(542..544,551..553,671..673,680..685,692..694) /gene="dlx1a" /gene_synonym="...
Synonym: dlx1
NM_001286290.1 - Haplochromis burtoni (Burton's mouthbrooder) - NCBI
Haplochromis burtoni distal-less homeobox 6a (dlx6a), mRNA. (1639 bp)
LOCUS NM_001286284 1639 bp mRNA linear VRT 12-APR-2020 DEFINITION Haplochromis burtoni distal-less homeobox 6a (dlx6a), mRNA. ACCESSION NM_001286284 XM_005928584 VERSION NM_001286284.1 KEYWORDS RefSeq. SOURCE Haplochromis burtoni (Burton's mouthbrooder) ORGANISM Haplochromis burtoni Eukaryota;...dlx6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 669..830 /gene="dlx6a" /gene_synonym="dlx6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(669..671,678..680,798..800,807..812,819..821) /gene="dlx6a" /gene_synonym="...
Synonym: dlx6
NM_001286284.1 - Haplochromis burtoni (Burton's mouthbrooder) - NCBI
Sus scrofa homeobox A13 (HOXA13), mRNA. (645 bp)
product="homeobox protein Hox-A13" /protein_id="NP_001182271.1" /db_xref="GeneID:100359352" /db_xref="VGNC:VGNC:88936" /translation="MTASVLLHPRWIEPTVMFLYDNGGGLVAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAPGPYHHHQPVPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS" misc_feature order(445..459,463..465,514..516,532..534,571..573, 577..582,589..594,598..606,610..615) /gene="HOXA13" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 451..612 /gene="HOXA13" /note="Homeobox domain;...
NM_001195342.1 - Sus scrofa (pig) - NCBI
Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. (1036 bp)
LOCUS NM_001129916 1036 bp mRNA linear VRT 02-MAY-2020 DEFINITION Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. ACCESSION NM_001129916 VERSION NM_001129916.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 427..585 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 296..546 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /inference="alignment:...
Synonym: vex1; Xvex-1
NM_001129916.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 KEYWORDS RefSeq. SOURCE Takifugu rubripes (torafugu) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (torafugu) - NCBI
Strongyloides ratti Homeobox domain and Homeobox KN domain and Homeodomain-like-containing protein (SRAE_2000258700), partial mRNA. (1398 bp)
LOCUS XM_024653672 1398 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Homeobox domain and Homeobox KN domain and Homeodomain-like-containing protein (SRAE_2000258700), partial mRNA. ACCESSION XM_024653672 VERSION XM_024653672.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is...
XM_024653672.1 - Strongyloides ratti - NCBI
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (2359 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..2359 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene <1..2359 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /db_xref="Araport:AT2G01430" /db_xref="GeneID:814671" /db_xref="TAIR:AT2G01430" CDS 1..642 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_001335062.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/homeobox
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.276 | 0.276 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.389 | 0.113 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.395 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]