GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2017-11-23 18:24:00, GGRNA : RefSeq release 85 (Nov, 2017)



Matches are highlighted with green background. Overlapping matches are dark colored.

Zea mays Zmhox1a homeobox protein (hox1a), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 02-OCT-2017 DEFINITION Zea mays Zmhox1a homeobox protein (hox1a), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript exon...
Synonym: GRMZM2G136369; homeobox1; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Gallus gallus paired related homeobox 1 (PRRX1), transcript variant 1, mRNA. (1879 bp)
oduct; homeobox protein MHOX; paired-related homeobox protein 1; transcription factor Prx1b" /codon_start=1 /product="paired mesoderm homeobox protein 1" /protein_id="NP_001264653.1" /db_xref="CGNC:48968" /db_xref="GeneID:373941" /translation="MASSYAHAMERQALLPARLDGPAGLDNLQAKKNFSVSHLLDLEEAGDMVAAQGDEGGGEPGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLASKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSTTCTNASPAQGMNMANSIANLRLKAKEYSLQRNQVPTVN" misc_feature 530..685 /gene="PRRX1" /gene_synonym="gMHox; homeobox; PMX1; Prx-1; Prx1" /note="Homeobox domain...
Synonym: gMHox; homeobox; PMX1; Prx-1; Prx1
NM_001277724.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus paired related homeobox 1 (PRRX1), transcript variant 2, mRNA. (895 bp)
oduct; homeobox protein MHOX; paired-related homeobox protein 1; transcription factor Prx1b" /codon_start=1 /product="paired mesoderm homeobox protein 1" /protein_id="NP_001007822.1" /db_xref="CGNC:48968" /db_xref="GeneID:373941" /translation="MASSYAHAMERQALLPARLDGPAGLDNLQAKKNFSVSHLLDLEEAGDMVAAQGDEGGGEPGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLASKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSTTCTNASPAQGMNMANSIANLRLKAKEYSLQRNQVPTVN" misc_feature 325..480 /gene="PRRX1" /gene_synonym="gMHox; homeobox; PMX1; Prx-1; Prx1" /note="Homeobox domain...
Synonym: gMHox; homeobox; PMX1; Prx-1; Prx1
NM_001007821.1 - Gallus gallus (chicken) - NCBI - UCSC
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 01-OCT-2017 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
MSX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(433..435,442..444,562..564,571..576,583..585) /gene="MSX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 804) AUTHORS Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH. TITLE The canine homeobox gene MSX2: sequence, chromosome assignment and genetic analysis in dogs of different breeds JOURNAL Anim. Genet...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Pan troglodytes HESX homeobox 1 (HESX1), mRNA. (558 bp)
codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_001075039.1" /db_xref="GeneID:747229" /db_xref="VGNC:VGNC:1836" /translation="MSPSLQEGAQLGESKPSTCSFSIERILGLDQNKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERALKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE" misc_feature order(325..339,343..345,394..396,412..414,451..453, 457..462,469..474,478..486,490..495) /gene="HESX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 331..492 /gene="HESX1" /note="Homeobox domain; Region: Homeobox...
NM_001081570.1 - Pan troglodytes (chimpanzee) - NCBI
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 01-OCT-2017 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
mol_type="mRNA" /strain="mixed" /db_xref="taxon:10116" /chromosome="4" /map="4q24" gene 1..1518 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox A5 (HOXA5), mRNA. (1191 bp)
Synonym: HOX1.3; HOX1C
NM_001318419.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus H6 family homeobox 3 (HMX3), mRNA. (927 bp)
LOCUS NM_001007985 927 bp mRNA linear VRT 01-OCT-2017 DEFINITION Gallus gallus H6 family homeobox 3 (HMX3), mRNA. ACCESSION NM_001007985 XM_426755 VERSION NM_001007985.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...NKX5-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 550..711 /gene="HMX3" /gene_synonym="NKX5-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(550..552,559..561,679..681,688..693,700..702) /gene="HMX3" /gene_synonym...
Synonym: NKX5-1
NM_001007985.1 - Gallus gallus (chicken) - NCBI - UCSC
Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. (555 bp)
LOCUS NM_001081487 555 bp mRNA linear PRI 02-OCT-2017 DEFINITION Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. ACCESSION NM_001081487 XM_001136381 XM_524055 VERSION NM_001081487.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 91..249 /gene="RAX2" /gene_synonym="RAXL1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
Synonym: RAXL1
NM_001081487.1 - Pan troglodytes (chimpanzee) - NCBI
Gallus gallus T-cell leukemia homeobox 1 (TLX1), mRNA. (894 bp)
" /db_xref="CDD:238039" misc_feature 511..672 /gene="TLX1" /gene_synonym="TLX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(511..513,520..522,640..642,649..654,661..663) /gene="TLX1" /gene_synonym="TLX-1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 894) AUTHORS Logan C, Wingate RJ, McKay IJ and Lumsden A. TITLE Tlx-1 and Tlx-3 homeobox gene expression in cranial sensory ganglia and hindbrain of the chick embryo: markers of patterned connectivity...
Synonym: TLX-1
NM_205015.1 - Gallus gallus (chicken) - NCBI - UCSC
Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. (1821 bp)
LOCUS NM_001165009 1821 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. ACCESSION NM_001165009 VERSION NM_001165009.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="drgx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..692 /gene="drgx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001165009.1 - Saccoglossus kowalevskii - NCBI
Ovis aries homeobox C6 (HOXC6), mRNA. (1196 bp)
LOCUS NM_001009335 1196 bp mRNA linear MAM 01-OCT-2017 DEFINITION Ovis aries homeobox C6 (HOXC6), mRNA. ACCESSION NM_001009335 VERSION NM_001009335.1 KEYWORDS RefSeq. SOURCE Ovis aries (sheep) ORGANISM Ovis aries Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria;...HOXC6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 199..357 /gene="HOXC6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" STS 58..267 /gene="HOXC6" /standard_name="MARC_44017-44022:1098368610:3" /db_xref="UniSTS...
NM_001009335.1 - Ovis aries (sheep) - NCBI
Rattus norvegicus Rhox homeobox family member 10 (Rhoxf10), mRNA. (606 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 606) AUTHORS Borgmann J, Tuttelmann F, Dworniczak B, Ropke A, Song HW, Kliesch S, Wilkinson MF, Laurentino S and Gromoll J. TITLE The human RHOX gene cluster: target genes and functional analysis of gene variants in infertile men JOURNAL Hum. Mol. Genet. 25 (22), 4898-4910 (2016) PUBMED 28171660 REFERENCE 2 (bases 1 to 606) AUTHORS Geserick C, Weiss B, Schleuning WD and Haendler B. TITLE OTEX, an androgen-regulated human member of the paired-like class of homeobox genes JOURNAL Biochem....
Synonym: Rhox10
NM_001037581.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus homeobox D13 (HOXD13), mRNA. (1964 bp)
LOCUS NM_205434 1964 bp mRNA linear VRT 01-OCT-2017 DEFINITION Gallus gallus homeobox D13 (HOXD13), mRNA. ACCESSION NM_205434 XM_429309 VERSION NM_205434.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 719..880 /gene="HOXD13" /gene_synonym="chox-4.8; chox-4G" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(719..721,728..730,848..850,857..862,869..871) /gene="HOXD13" /gene_...
Synonym: chox-4.8; chox-4G
NM_205434.1 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-3.S), mRNA. (742 bp)
gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(374..376,383..385,503..505,512..517,524..526) /gene="nkx3-3.S" /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 742) AUTHORS Newman CS and Krieg PA. TITLE The Xenopus bagpipe-related homeobox gene zampogna is expressed in the pharyngeal endoderm and the visceral musculature of the midgut...
Synonym: bapx; nkx3-3; nkx3-3.L; zampogna; zax; zax-A
NM_001085685.1 - Xenopus laevis (African clawed frog) - NCBI
Pan troglodytes homeobox D4 (HOXD4), mRNA. (768 bp)
LOCUS NM_001081569 768 bp mRNA linear PRI 02-OCT-2017 DEFINITION Pan troglodytes homeobox D4 (HOXD4), mRNA. ACCESSION NM_001081569 XM_001153123 VERSION NM_001081569.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="HOXD4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 469..630 /gene="HOXD4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(469..471,478..480,598..600,607..612,619..621) /gene="HOXD4" /note="specific DNA base...
NM_001081569.1 - Pan troglodytes (chimpanzee) - NCBI
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 8..75 /gene="HOXA6" /standard_name="Hoxa6" /db_xref="UniSTS:536644" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Xenopus tropicalis H6 family homeobox 3 (hmx3), mRNA. (2200 bp)
LOCUS NM_001079361 2200 bp mRNA linear VRT 02-OCT-2017 DEFINITION Xenopus tropicalis H6 family homeobox 3 (hmx3), mRNA. ACCESSION NM_001079361 VERSION NM_001079361.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 763..924 /gene="hmx3" /gene_synonym="nkx-5.1; nkx5-1; nkx5.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(763..765,772..774,892..894,901..906,913..915) /gene="hmx3" /gene_...
Synonym: nkx-5.1; nkx5-1; nkx5.1
NM_001079361.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (886 bp)
t="homeobox protein MIXL1" /protein_id="NP_990321.1" /db_xref="CGNC:66215" /db_xref="GeneID:395838" /translation="MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLASLPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL" misc_feature order(176..190,194..196,245..247,263..265,302..304, 308..313,320..325,329..337,341..346) /gene="MIXL1" /gene_synonym="CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 182..343 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox...
Synonym: CMIX
NM_204990.1 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus laevis VENT homeobox 3, gene 2 S homeolog (ventx3.2.S), mRNA. (1072 bp)
vex1; xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1072) AUTHORS Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and Richardson P. TITLE Genetic and genomic tools for Xenopus research: The NIH Xenopus initiative JOURNAL Dev. Dyn. 225 (4), 384-391 (2002) PUBMED 12454917 REFERENCE 2 (bases 1 to 1072) AUTHORS Shapira E, Marom1 K, Levy V, Yelin R and Fainsod A. TITLE The Xvex-1 antimorph reveals the temporal competence for organizer formation and an early role for ventral homeobox genes JOURNAL Mech. Dev...
Synonym: ventx3.2; vex1; xvex-1
NM_001088485.1 - Xenopus laevis (African clawed frog) - NCBI
Gallus gallus goosecoid homeobox (GSC), mRNA. (936 bp)
ct="homeobox protein goosecoid" /protein_id="NP_990662.1" /db_xref="CGNC:8338" /db_xref="GeneID:396273" /translation="MPASMFSIDNILAARPRCKDSVLLPPSAPVVFPSLHGDSLYGAASDYGGFYSRAVAPGSALPAVGRSRLGYNNYYYGQLHVATSPVGPSCCGAVPPLGAQQCSCVPPAGYEGAGSVLMSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAQKWNKASKTSPEKRQEDGKSDLDSDS" misc_feature order(451..465,469..471,520..522,538..540,577..579, 583..588,595..600,604..612,616..621) /gene="GSC" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 457..618 /gene="GSC" /note="Homeobox...
NM_205331.1 - Gallus gallus (chicken) - NCBI - UCSC
Pan troglodytes homeobox B1 (HOXB1), mRNA. (906 bp)
LOCUS NM_001081572 906 bp mRNA linear PRI 02-OCT-2017 DEFINITION Pan troglodytes homeobox B1 (HOXB1), mRNA. ACCESSION NM_001081572 XM_001173083 VERSION NM_001081572.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="HOXB1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 619..777 /gene="HOXB1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(625..627,745..747,754..759,766..768) /gene="HOXB1" /note="specific DNA base contacts...
NM_001081572.1 - Pan troglodytes (chimpanzee) - NCBI
Gallus gallus homeobox D11 (HOXD11), mRNA. (1006 bp)
LOCUS NM_204620 1006 bp mRNA linear VRT 01-OCT-2017 DEFINITION Gallus gallus homeobox D11 (HOXD11), mRNA. ACCESSION NM_204620 XM_001234561 VERSION NM_204620.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...GHOX4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 709..870 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(709..711,718..720,838..840,847..852,859..861) /gene="HOXD11" /gene_...
Synonym: GHOX4.6
NM_204620.1 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. (1036 bp)
LOCUS NM_001129916 1036 bp mRNA linear VRT 02-OCT-2017 DEFINITION Xenopus tropicalis VENT homeobox 3, gene 2 (ventx3.2), mRNA. ACCESSION NM_001129916 VERSION NM_001129916.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 427..585 /gene="ventx3.2" /gene_synonym="vex1; Xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1036) AUTHORS Klein SL, Strausberg RL, Wagner L,...
Synonym: vex1; Xvex-1
NM_001129916.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis engrailed homeobox 1 L homeolog (en1.L), mRNA. (1465 bp)
gene="en1.L" /gene_synonym="en-1; En-1A; en1-a; en1-b; en1a; eng1; engrailed-1; xen1" /note="engrailed homeobox 1 L homeolog" /db_xref="GeneID:735177" /db_xref="Xenbase:XB-GENE-6254268" misc_feature 104..106 /gene="en1.L" /gene_synonym="en-1; En-1A; en1-a; en1-b; en1a; eng1; engrailed-1; xen1" /note="upstream in-frame stop codon" CDS 215..904 /gene="en1.L" /gene_synonym="en-1; En-1A; en1-a; en1-b; en1a; eng1; engrailed-1; xen1" /note="engrailed 1; En-1a homeobox protein; Homeobox protein en-1-A" /codon_start=1 /product="homeobox protein engrailed-1-A" /protein_id="NP_001090102.1" /db_xref="...
Synonym: en-1; En-1A; en1-a; en1-b; en1a; eng1; engrailed-1; xen1
NM_001096633.1 - Xenopus laevis (African clawed frog) - NCBI
Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. (2158 bp)
LOCUS NM_001164939 2158 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. ACCESSION NM_001164939 VERSION NM_001164939.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 487..645 /gene="hox6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2158) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164939.1 - Saccoglossus kowalevskii - NCBI
Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. (1845 bp)
LOCUS NM_205252 1845 bp mRNA linear VRT 01-OCT-2017 DEFINITION Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. ACCESSION NM_205252 VERSION NM_205252.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..686 /gene="HHEX" /gene_synonym="PROBOX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1845) AUTHORS Obinata A and Akimoto Y. TITLE Involvement of...
Synonym: PROBOX
NM_205252.1 - Gallus gallus (chicken) - NCBI - UCSC
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Gallus gallus homeobox D8 (HOXD8), mRNA. (1263 bp)
LOCUS NM_207177 1263 bp mRNA linear VRT 01-OCT-2017 DEFINITION Gallus gallus homeobox D8 (HOXD8), mRNA. ACCESSION NM_207177 VERSION NM_207177.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...HOXD8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 460..618 /gene="HOXD8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" variation complement(329) /gene="HOXD8" /replace="g" /replace="t" /db_xref="dbSNP...
NM_207177.1 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus laevis ventral anterior homeobox 1 S homeolog (vax1.S), mRNA. (888 bp)
vax; vax1; vax1-a; vax1-b; vax1b; vax1b-a; xvax1; xvax1b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(298..300,307..309,427..429,436..441,448..450) /gene="vax1.S" /gene_synonym="vax; vax1; vax1-a; vax1-b; vax1b; vax1b-a; xvax1; xvax1b" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 888) AUTHORS Hallonet M, Hollemann T, Wehr R, Jenkins NA, Copeland NG, Pieler T and Gruss P. TITLE Vax1 is a novel homeobox-containing gene expressed in the developing anterior ventral...
Synonym: vax; vax1; vax1-a; vax1-b; vax1b; vax1b-a; xvax1; xvax1b
NM_001085680.1 - Xenopus laevis (African clawed frog) - NCBI
Pan troglodytes goosecoid homeobox (GSC), mRNA. (774 bp)
LOCUS NM_001081486 774 bp mRNA linear PRI 02-OCT-2017 DEFINITION Pan troglodytes goosecoid homeobox (GSC), mRNA. ACCESSION NM_001081486 XM_522943 VERSION NM_001081486.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="GSC" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 487..648 /gene="GSC" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(487..489,496..498,616..618,625..630,637..639) /gene="GSC" /note="specific DNA base contacts...
NM_001081486.1 - Pan troglodytes (chimpanzee) - NCBI
Xenopus laevis homeobox B7 L homeolog (hoxb7.L), mRNA. (1327 bp)
P52; xlHbox-2 B; homeobox B7 S homeolog" /codon_start=1 /product="homeobox protein Hox-B7-B" /protein_id="NP_001084118.1" /db_xref="GeneID:399312" /db_xref="Xenbase:XB-GENE-6254051" /translation="MSSLYYANALFSKYPTATSVFPSGVFSEQTSCAFASSPQRSGYGNSPGGTFPAGSAAHGLFSNGSSLHPQSPAMYPSSYGLDAASFNMHCSPFEQNLSSLMCDPTKQNCTKAEQRDSELHNEANLRIYPWMRSAGSDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKASSPSSNSQEKPET" mat_peptide 18..677 /gene="hoxb7.L" /gene_synonym="Hbox2; hho.c1; hox-2.3; hox2; hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; Xhox45; XlHbox2" /product="Homeobox protein Hox-B7-B" /...
Synonym: Hbox2; hho.c1; hox-2.3; hox2; hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; Xhox45; XlHbox2
NM_001090649.1 - Xenopus laevis (African clawed frog) - NCBI
Rattus norvegicus H2.0-like homeobox (Hlx), mRNA. (2141 bp)
specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1148..1309 /gene="Hlx" /gene_synonym="Hlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" variation complement(2015) /gene="Hlx" /gene_synonym="Hlx1" /replace="a" /replace="g" /db_xref="dbSNP:8143370" ORIGIN // REFERENCE 1 (bases 1 to 2141) AUTHORS Bates MD, Dunagan DT, Welch LC, Kaul A and Harvey RP. TITLE The Hlx homeobox transcription factor is required early in enteric nervous system development JOURNAL BMC Dev. Biol. 6, 33 (2006) PUBMED 16854219 REMARK Publication...
Synonym: Hlx1
NM_001077674.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Gallus gallus H6 family homeobox 1 (HMX1), mRNA. (1018 bp)
LOCUS NM_205533 1018 bp mRNA linear VRT 04-OCT-2017 DEFINITION Gallus gallus H6 family homeobox 1 (HMX1), mRNA. ACCESSION NM_205533 VERSION NM_205533.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...synonym="GH6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 507..668 /gene="HMX1" /gene_synonym="GH6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(507..509,516..518,636..638,645..650,657..659) /gene="HMX1" /gene_...
Synonym: GH6
NM_205533.2 - Gallus gallus (chicken) - NCBI - UCSC
Brassica napus homeobox-leucine zipper protein ATHB-6-like (LOC106363703), mRNA. (1572 bp)
LOCUS NM_001315814 1572 bp mRNA linear PLN 09-OCT-2017 DEFINITION Brassica napus homeobox-leucine zipper protein ATHB-6-like (LOC106363703), mRNA. ACCESSION NM_001315814 VERSION NM_001315814.1 KEYWORDS RefSeq. SOURCE Brassica napus (rape) ORGANISM Brassica napus Eukaryota; Viridiplantae;...gene="LOC106363703" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 390..551 /gene="LOC106363703" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(390..392,399..401,519..521,528..533,540..542) /gene="LOC106363703" /note="...
NM_001315814.1 - Brassica napus (rape) - NCBI
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 KEYWORDS RefSeq. SOURCE Takifugu rubripes (Fugu rubripes) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata; Craniata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (Fugu rubripes) - NCBI
Xenopus laevis ladybird homeobox 1 L homeolog (lbx1.L), mRNA. (804 bp)
LOCUS NM_001095723 804 bp mRNA linear VRT 01-OCT-2017 DEFINITION Xenopus laevis ladybird homeobox 1 L homeolog (lbx1.L), mRNA. ACCESSION NM_001095723 VERSION NM_001095723.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 388..549 /gene="lbx1.L" /gene_synonym="hpx-6; hpx6; lbx1h" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(388..390,397..399,517..519,526..531,538..540) /gene="lbx1.L" /gene_...
Synonym: hpx-6; hpx6; lbx1h
NM_001095723.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis H6 family homeobox 3 L homeolog (hmx3.L), mRNA. (1417 bp)
nkx-5.1; nkx-5.1-A; nkx5-1; nkx5.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(773..775,782..784,902..904,911..916,923..925) /gene="hmx3.L" /gene_synonym="hmx3; nkx-5.1; nkx-5.1-A; nkx5-1; nkx5.1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1 (bases 1 to 1417) AUTHORS Bayramov AV, Martynova NY, Eroshkin FM, Ermakova GV and Zaraisky AG. TITLE The homeodomain-containing transcription factor X-nkx-5.1 inhibits expression of the homeobox gene Xanf-1 during the Xenopus laevis...
Synonym: hmx3; nkx-5.1; nkx-5.1-A; nkx5-1; nkx5.1
NM_001085757.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-2.S), mRNA. (990 bp)
LOCUS NM_001085813 990 bp mRNA linear VRT 02-OCT-2017 DEFINITION Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-2.S), mRNA. ACCESSION NM_001085813 VERSION NM_001085813.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata;..." /db_xref="CDD:238039" misc_feature 613..774 /gene="nkx3-2.S" /gene_synonym="bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(613..615,622..624,742..744,751..756,763..765) /gene="nkx3-2.S" /gene_...
Synonym: bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap
NM_001085813.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis ventral anterior homeobox 2 S homeolog (vax2.S), mRNA. (885 bp)
upstream domain" misc_feature 292..474 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="Region: homeobox" misc_feature order(295..309,313..315,364..366,382..384,421..423, 427..432,439..444,448..456,460..465) /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 301..462 /gene="vax2.S" /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(301..303,310..312,430..432,439..444,451..453) /...
Synonym: dres93; vax2-a; vax2-b; vax3; xvax2
NM_001172204.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis homeobox B6 S homeolog (hoxb6.S), mRNA. (1524 bp)
LOCUS NM_001096910 1524 bp mRNA linear VRT 01-OCT-2017 DEFINITION Xenopus laevis homeobox B6 S homeolog (hoxb6.S), mRNA. ACCESSION NM_001096910 VERSION NM_001096910.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata;...; other site" /db_xref="CDD:238039" misc_feature 482..640 /gene="hoxb6.S" /gene_synonym="hox-2.2; hox2b; hoxb6; XlHox-2.2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1524) AUTHORS Klein SL, Strausberg RL, Wagner L, Pontius J,...
Synonym: hox-2.2; hox2b; hoxb6; XlHox-2.2
NM_001096910.1 - Xenopus laevis (African clawed frog) - NCBI
Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. (1822 bp)
LOCUS NM_001164980 1822 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. ACCESSION NM_001164980 VERSION NM_001164980.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 355..474 /gene="tgif1" /gene_synonym="tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 1822) AUTHORS Freeman,R.M. Jr., Wu,M., Cordonnier-...
Synonym: tgif
NM_001164980.1 - Saccoglossus kowalevskii - NCBI
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_053630) mRNA, complete cds. (747 bp)
locus_tag="EIN_053630" /note="encoded by transcript EIN_053630A" /codon_start=1 /product="homeobox protein knotted-1, putative" /protein_id="XP_004259889.1" /db_xref="GeneID:14892326" /translation="MEPTQEVQKVLTECVNKTIDFDQYLKCFEQSLVRPSGDISDQSLMEKVQHVADLVTGEKLLRLNELVQIFNSQAEVLYLYYTSYYTQLVSLLDSQSQKRIVTQDERSYKISCLRALFGNIYSHLKLMFGSNVSSLAPRERKIPTFLSPQISVHSITSQSQPLSKITCKNSLVLSSTKPTKPIFKIDKIKTQSPKTQKIKPLLDWFVLHSNHPYPTEEQKERLGSECGMSPKQVGTWFSNKRNRNKNQN" misc_feature 610..711 /locus_tag="EIN_053630" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1...
XM_004259841.1 - Entamoeba invadens IP1 - NCBI
Xenopus laevis gastrulation brain homeobox 2, gene 2 L homeolog (gbx2.2.L), mRNA. (2310 bp)
LOCUS NM_001087947 2310 bp mRNA linear VRT 02-OCT-2017 DEFINITION Xenopus laevis gastrulation brain homeobox 2, gene 2 L homeolog (gbx2.2.L), mRNA. ACCESSION NM_001087947 NM_001087948 VERSION NM_001087947.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1390..1551 /gene="gbx2.2.L" /gene_synonym="gbx2; gbx2.2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1390..1392,1399..1401,1519..1521,1528..1533, 1540..1542) /gene="...
Synonym: gbx2; gbx2.2
NM_001087947.1 - Xenopus laevis (African clawed frog) - NCBI
Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. (2551 bp)
LOCUS NM_001164940 2551 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. ACCESSION NM_001164940 VERSION NM_001164940.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox9/10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1170..1331 /gene="hox9/10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1170..1172,1179..1181,1299..1301,1308..1313, 1320..1322) /gene="hox9/10" /note="...
NM_001164940.1 - Saccoglossus kowalevskii - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.138 | 0.138 | count_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.234 | 0.096 | search_done;*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.240 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]