ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-11-03 15:00:52, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_130055 1394 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana homeobox-leucine zipper protein 4 (HB4), mRNA. ACCESSION NM_130055 VERSION NM_130055.2 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 1394) AUTHORS Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D., Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V., Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L., Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L., Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H., Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D., Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and Venter,J.C. TITLE Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana JOURNAL Nature 402 (6763), 761-768 (1999) PUBMED 10617197 REFERENCE 2 (bases 1 to 1394) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1394) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 1394) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003071). On Sep 12, 2016 this sequence version replaced NM_130055.1. FEATURES Location/Qualifiers source 1..1394 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene 1..1394 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="Encodes a homeodomain protein whose expression displays a dependence on phyB for both red and far-red light response. Also involved in the shade avoidance syndrome." /db_xref="Araport:AT2G44910" /db_xref="GeneID:819100" /db_xref="TAIR:AT2G44910" CDS 207..1163 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /inference="Similar to RNA sequence, EST:INSD:DR751659.1,INSD:DR751658.1,INSD:EL294024.1" /inference="similar to RNA sequence, mRNA:INSD:AJ441251.1" /note="homeobox-leucine zipper protein 4 (HB4); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to hormone stimulus, shade avoidance, regulation of transcription, DNA-dependent, response to far red light, regulation of gene-specific transcription; LOCATED IN: nucleus; EXPRESSED IN: 8 plant structures; EXPRESSED DURING: 4 anthesis, F mature embryo stage, petal differentiation and expansion stage, E expanded cotyledon stage, D bilateral stage; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), HD-ZIP protein, N-terminal (InterPro:IPR006712), Homeodomain-like (InterPro:IPR009057), Leucine zipper, homeobox-associated (InterPro:IPR003106), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: homeobox-leucine zipper protein 3 (TAIR:AT3G60390.1); Has 8851 Blast hits to 8789 proteins in 513 species: Archae - 0; Bacteria - 2; Metazoa - 6351; Fungi - 241; Plants - 2079; Viruses - 4; Other Eukaryotes - 174 (source: NCBI BLink)." /codon_start=1 /product="homeobox-leucine zipper protein 4" /protein_id="NP_182018.1" /db_xref="Araport:AT2G44910" /db_xref="GeneID:819100" /db_xref="TAIR:AT2G44910" /translation="
MGERDDGLGLSLSLGNSQQKEPSLRLNLMPLTTSSSSSSFQHMHNQNNNSHPQKIHNISWTHLFQSSGIKRTTAERNSDAGSFLRGFNVNRAQSSVAVVDLEEEAAVVSSPNSAVSSLSGNKRDLAVARGGDENEAERASCSRGGGSGGSDDEDGGNGDGSRKKLRLSKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRRLQKEVSELRALKLSPHLYMHMTPPTTLTMCPSCERVSSSAATVTAAPSTTTTPTVVGRPSPQRLTPWTAISLQQKSGR"
misc_feature 228..578
/gene="HB4"
/locus_tag="AT2G44910"
/gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper
protein 4; T13E15.8"
/note="HD-ZIP protein N terminus; Region: HD-ZIP_N;
pfam04618"
/db_xref="CDD:461370"
misc_feature 690..854
/gene="HB4"
/locus_tag="AT2G44910"
/gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper
protein 4; T13E15.8"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
misc_feature 858..989
/gene="HB4"
/locus_tag="AT2G44910"
/gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper
protein 4; T13E15.8"
/note="homeobox associated leucin zipper; Region: HALZ;
smart00340"
/db_xref="CDD:128634"
ORIGIN
cattgaaattacaagggtctttctgacacaagtcatcattgaaaccccaagcaccccacataaccccttctctctattaattgtctacatatcaacttctgtgtatatatatattagtcgtgtctttaaccccattatcactacatcgattttctcgagaaagtctttcaaaatccagaaaagaaaagttctttctgttgaggacaatgggggaaagagatgatgggttgggtttgagtctaagcttgggaaatagtcaacaaaaagaaccatctctgaggttgaatcttatgccgttgacaacttcttcttcttcttcttcgtttcaacacatgcacaatcagaataacaatagccatccccagaagattcataacatctcttggactcatctgtttcaatcttctgggattaaacgtacaactgcagagagaaactccgacgccgggtcatttctaagaggtttcaacgtgaacagagctcagtcttcggtggcggtagtggacttggaagaagaagccgccgtcgtctcgtctccaaacagcgccgtttcgagtctgagtggaaataaaagggatcttgcggtggcgagaggaggagatgaaaacgaggcggagagagcttcttgctcacgcggagggggaagcggtggtagcgacgatgaagacggcggaaacggcgacggatcaaggaagaaactacggttatcgaaggatcaagctcttgttctcgaggagacttttaaagaacatagcactcttaatccgaagcaaaagctggctctagcaaaacagttgaatctaagggcaagacaagttgaagtgtggtttcagaaccgtagggcaaggacgaagctgaaacaaacggaggttgattgtgagtatttaaagagatgttgcgataatctgaccgaggagaatcgacggctgcagaaagaagtgtcggagctgagggcgttgaagttgtctccacatctctacatgcacatgactcctcctactactctcaccatgtgcccttcttgcgaacgtgtctcctcctctgccgccactgtgaccgctgctccttccactactactactcctacggtggtggggcggccaagtccacagcgattaactccttggactgctatttctctccagcaaaaatcaggtcgctagggaaggagtatcttcggtagttttagcttagaataaagatatgagtatgaaagtttcaaagattagcttctatctattgaaaatgaaaacaaagattagtctcaattcaaagggttcaatttgaggctctaattctgaatttgttttaacctgtaaaaggattaccctttttagaattcagttttgtgagtatatttgattgtttattacctctaaaatcatgagagagat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]