GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-14 19:30:04, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_127411               1058 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana homeobox protein 21 (HB21), mRNA.
ACCESSION   NM_127411
VERSION     NM_127411.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1058)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 1058)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1058)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1058)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003071).
            
            On Sep 12, 2016 this sequence version replaced NM_127411.1.
FEATURES             Location/Qualifiers
     source          1..1058
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            1..1058
                     /gene="HB21"
                     /locus_tag="AT2G18550"
                     /gene_synonym="ATHB21; F24H14.10; F24H14_10; HB-2;
                     homeobox protein 21; homeobox-2"
                     /note="Encodes a homeodomain leucine zipper class I
                     (HD-Zip I) protein."
                     /db_xref="Araport:AT2G18550"
                     /db_xref="GeneID:816370"
                     /db_xref="TAIR:AT2G18550"
     CDS             104..766
                     /gene="HB21"
                     /locus_tag="AT2G18550"
                     /gene_synonym="ATHB21; F24H14.10; F24H14_10; HB-2;
                     homeobox protein 21; homeobox-2"
                     /inference="Similar to RNA sequence,
                     EST:INSD:ES019890.1,INSD:ES010284.1,INSD:DR750744.1,
                     INSD:ES047796.1,INSD:DR750688.1,INSD:DR750747.1,
                     INSD:DR750746.1,INSD:DR750857.1,INSD:DR750745.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT031362.1,INSD:BT031368.1"
                     /note="homeobox protein 21 (HB21); FUNCTIONS IN: DNA
                     binding, sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: regulation of transcription,
                     DNA-dependent, regulation of transcription; LOCATED IN:
                     nucleus; EXPRESSED IN: 21 plant structures; EXPRESSED
                     DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
                     Homeobox, conserved site (InterPro:IPR017970), Homeobox
                     (InterPro:IPR001356), Homeodomain-like
                     (InterPro:IPR009057), Helix-turn-helix motif, lambda-like
                     repressor (InterPro:IPR000047), Homeodomain-related
                     (InterPro:IPR012287); BEST Arabidopsis thaliana protein
                     match is: homeobox protein 40 (TAIR:AT4G36740.1); Has 7525
                     Blast hits to 7522 proteins in 427 species: Archae - 0;
                     Bacteria - 0; Metazoa - 5302; Fungi - 235; Plants - 1881;
                     Viruses - 3; Other Eukaryotes - 104 (source: NCBI BLink)."
                     /codon_start=1
                     /product="homeobox protein 21"
                     /protein_id="NP_179445.1"
                     /db_xref="Araport:AT2G18550"
                     /db_xref="GeneID:816370"
                     /db_xref="TAIR:AT2G18550"
                     /translation="
MNNQNVDDHNLLLISQLYPNVYTPLVPQQGGEAKPTRRRKRKSKSVVVAEEGENEGNGWFRKRKLSDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVEDEYTKLKNAYETTVVEKCRLDSEVIHLKEQLYEAEREIQRLAKRVEGTLSNSPISSSVTIEANHTTPFFGDYDIGFDGEADENLLYSPDYIDGLDWMSQFM"
     misc_feature    order(284..292,296..298,347..349,365..367,404..406,
                     410..415,422..427,431..439,443..448)
                     /gene="HB21"
                     /locus_tag="AT2G18550"
                     /gene_synonym="ATHB21; F24H14.10; F24H14_10; HB-2;
                     homeobox protein 21; homeobox-2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    284..445
                     /gene="HB21"
                     /locus_tag="AT2G18550"
                     /gene_synonym="ATHB21; F24H14.10; F24H14_10; HB-2;
                     homeobox protein 21; homeobox-2"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(284..286,293..295,413..415,422..427,434..436)
                     /gene="HB21"
                     /locus_tag="AT2G18550"
                     /gene_synonym="ATHB21; F24H14.10; F24H14_10; HB-2;
                     homeobox protein 21; homeobox-2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
ORIGIN      
acatcttctcttattgcagaaaaggtgagacaaaaaacatcaccaatcttttgaatctaagagagagaagaagaagaaggtctagagaacgaaaagaagaaacatgaataaccagaatgtagatgatcataatcttctactcatttctcaattgtaccctaatgtctatactccattagtaccacaacaaggaggagaagcaaaaccaacacggcggaggaaaaggaagagcaagagtgttgtggtggcagaggagggtgaaaacgaaggcaatgggtggtttagaaagagaaaattgagtgatgagcaagtaagaatgttggagattagctttgaagacgatcataagcttgaatccgagaggaaagatcggcttgcttctgagttagggcttgatcctcgtcaagtcgccgtctggttccaaaaccgccgtgcacggtggaagaacaaacgagtcgaggatgaatacactaaactcaagaatgcatacgaaaccaccgtcgttgagaaatgtcgtcttgattctgaggttattcacctaaaggaacaactttacgaggctgaaagagagatccaacggcttgcaaaaagagttgaaggaactttaagtaacagtcctatctcatcctctgtgaccattgaagccaatcatacgacaccgttttttggagattacgacatcggatttgacggtgaggctgacgagaacttgctctactcgccagattacattgatggattagactggatgagccaatttatgtaaaaaactataagctaatctattttcagtcgtagtatagtatataaatatataggggttaattgtgacaattacattaatttatgattggtcgatatctacaatgaagcaggatgtagataaaattatgggcctattcgctagtgtaatattgtggatatctttctcgtagcatcgattatttaggtcgatggaggtcaagtttggacccaagaaaaaaagaatgtatatatctgtcaattataagtaaattgtatatttctattgatctagttatagaaatattaagcataaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]