ver.2
Help
|
Advanced search
|
Japanese
Previous release (v1)
2021-04-23 23:41:56, GGRNA : RefSeq release 205 (Mar, 2021)
Summary:
Results:
Matches are highlighted with green background.
Overlapping matches are dark colored.
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Nov 23, 2018 this sequence version replaced NM_001307.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
gene_synonym="claudin1" /note="upstream in-frame stop codon" CDS 228..863 /gene="CLDN1" /gene_synonym="claudin1" /note="claudin-1 protein" /codon_start=1 /product="claudin-1" /protein_id="NP_001231468.1" /db_xref="GeneID:100625166" /db_xref="VGNC:VGNC:103926" /translation="MANAGLQLLGFILAFLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNTTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 240..746 /gene="CLDN1" /gene_synonym="claudin1" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym:
claudin1
NM_001244539.1 -
Sus scrofa (pig) -
NCBI
gene="Cldn19" /gene_synonym="claudin-19" /note="upstream in-frame stop codon" CDS 85..720 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19" /protein_id="NP_001008514.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREYV" misc_feature 94..630 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins...
xref="RGD:1305000" CDS 413..1087 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19 isoform X1" /protein_id="XP_006238818.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREPVVKLSTSVKGPLGV" misc_feature 422..958 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
cb388; claudin7; cld; cldn7; fd19f08; wu:fd19f08" /note="claudin-like protein ZF4A22; claudin-7" /codon_start=1 /product="claudin-7-B" /protein_id="NP_571712.1" /db_xref="GeneID:60635" /db_xref="ZFIN:ZDB-GENE-001103-5" /translation="MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTGQQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAMTGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGGMLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV" misc_feature 165..701 /gene="cldn7b" /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08; wu:fd19f08" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: cb388;
claudin7; cld; cldn7; fd19f08; wu:fd19f08
NM_131637.1 -
Danio rerio (zebrafish) -
NCBI -
UCSC
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC003688.1, AJ011497.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185022.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2;
claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.2 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185023.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2;
claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.2 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
membrane protein claudin-2" /codon_start=1 /product="claudin-2" /protein_id="NP_001003089.1" /db_xref="GeneID:403649" /db_xref="VGNC:VGNC:39316" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVVGGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 80..142 /gene="CLDN2" /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1); transmembrane region" misc_feature 125..601 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin...
NM_001003089.1 -
Canis lupus familiaris (dog) -
NCBI
note="claudin 18-like" /codon_start=1 /product="claudin-18 precursor" /protein_id="NP_001014118.1" /db_xref="GeneID:315953" /db_xref="RGD:1359696" /translation="MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVQQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLTSGIMFIISGVCAIIGVSVFANMLVTNFWMSTANMYSGMGGMVQTVQTRYTFGAALFVGWIAGGLTLIGGVMMCIACRGLTPDDRNFKAVSYHASGQNVAYKPGGFKASTGFGSNARNKKIYDGGARTEDDEQSHPTKYDYV" sig_peptide 33..101 /gene="Cldn18" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature <159..605 /gene="Cldn18" /note="PMP-22/EMP/MP20/Claudin family;...
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160098.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160097.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160096.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160099.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
is encoded by transcript variant 3" /codon_start=1 /product="claudin-19 isoform c" /protein_id="NP_001172046.1" /db_xref="CCDS:CCDS53306.1" /db_xref="GeneID:149461" /db_xref="HGNC:HGNC:2040" /db_xref="MIM:610036" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGMNLAQPCSWAGPQLAWPCWAAPSSAAHARSQRDPTAAHSPIGLDPLLLPESTSELRLPWPAPHPVAPLPSIQPASQHPGQGHWGIGWA" misc_feature 183..>590 /gene="CLDN19" /gene_synonym="HOMG5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym:
claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 -
Xenopus tropicalis (tropical clawed frog) -
NCBI
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_023878.3 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
stop codon" CDS 441..1100 /gene="Cldn3" /note="RVP1; ventral prostate.1 protein" /codon_start=1 /product="claudin-3" /protein_id="NP_113888.2" /db_xref="GeneID:65130" /db_xref="RGD:68425" /translation="MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVAGVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALLCCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV" misc_feature 447..941 /gene="Cldn3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" misc_feature 465..527 /gene="Cldn3" /note="...
Data-START## Transcript exon combination :: KM870792.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1474 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="7" /map="7" gene 1..1474 /gene="cldn15a" /gene_synonym="Claudin-15; cldn15" /note="claudin 15a" /db_xref="GeneID:108267636" misc_feature 222..224 /gene="cldn15a" /gene_synonym="Claudin-15; cldn15" /note="upstream in-frame stop codon" CDS 282..953 /gene="cldn15a" /gene_synonym="Claudin-15; cldn15" /note="claudin 15" /codon_start=1 /product="claudin-15" /protein_id="NP...
Synonym:
Claudin-15; cldn15
NM_001329306.1 -
Ictalurus punctatus (channel catfish) -
NCBI
musculus claudin 17 (Cldn17), mRNA. ACCESSION NM_181490 VERSION NM_181490.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK048287.1. On Apr 5, 2007 this sequence version replaced NM_181490.2. Summary: This gene encodes a member of the claudin family. Claudins are...
single sample supports all introns SAMN00774075 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1765 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="17" /map="17" gene 1..1765 /gene="cldn15lb" /gene_synonym="Claudin-10; cldn1; CLDN10; CLDN26" /note="claudin 15-like b" /db_xref="GeneID:108278410" exon 1..879 /gene="cldn15lb" /gene_synonym="Claudin-10; cldn1; CLDN10; CLDN26" /inference="alignment:Splign:2.1.0" misc_feature 810..812 /gene="cldn15lb" /gene_synonym="Claudin-10; cldn1; CLDN10; CLDN26" /note="upstream in-frame stop codon...
Synonym:
Claudin-10; cldn1; CLDN10; CLDN26
NM_001329305.1 -
Ictalurus punctatus (channel catfish) -
NCBI
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1;
claudin-5; cpetrl1; tmvcf
NM_001006706.1 -
Xenopus tropicalis (tropical clawed frog) -
NCBI
gene_synonym="claudin-8" /inference="alignment:Splign:2.0.8" CDS 31..711 /gene="cldn8.4" /gene_synonym="claudin-8" /codon_start=1 /product="claudin 8, gene 2" /protein_id="NP_001120297.1" /db_xref="GeneID:100145356" /db_xref="Xenbase:XB-GENE-991592" /translation="MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV" misc_feature 31..567 /gene="cldn8.4" /gene_synonym="claudin-8" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym:
claudin-8
NM_001126825.1 -
Xenopus tropicalis (tropical clawed frog) -
NCBI
CDS 152..787 /gene="cldn1" /gene_synonym="claudin-1; cld1; ilvasc; semp1" /note="Xclaudin 1" /codon_start=1 /product="claudin-1" /protein_id="NP_001015704.1" /db_xref="GeneID:548421" /db_xref="Xenbase:XB-GENE-951609" /translation="MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKTYDSLLKLDSTMQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGNKIAKDFYNVFTPTNSKYEFGPALFIGWAGAALAILGGALLCCSCPRRETSYPPPRGYNKSAPPAGKDYV" misc_feature 164..697 /gene="cldn1" /gene_synonym="claudin-1; cld1; ilvasc; semp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym:
claudin-1; cld1; ilvasc; semp1
NM_001015704.1 -
Xenopus tropicalis (tropical clawed frog) -
NCBI
synonym="CLDN33c; si:dkey-98f17.3" /note="claudin 33c; putative claudin-24" /codon_start=1 /product="uncharacterized protein LOC793143 homolog" /protein_id="NP_001316176.1" /db_xref="GeneID:108255719" /translation="MYRERKEPELTMVLLTTKIVQRASLFVAFGGLVTTFITTFLPLWKTMNSELNEMENWYEGLWHMCIFTEEVGLHCKAFESLLALPPVTLASRILMCVSIATGFLGVLAAFFGLDGVEIGAGRDRLKRGLLILGGVLIWVSGLTTLAPVSLIAYVMVVEFWDGGLPDVMPRWEYGEAMFSAWFSGLLLVIGGSFIFVAVCMRDHEEKQQREIFSPAHELQPRTQHYLKTEVL" misc_feature 727..1227 /gene="cldn26" /gene_synonym="CLDN33c; si:dkey-98f17.3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: CLDN33c; si:dkey-98f17.3
NM_001329247.1 -
Ictalurus punctatus (channel catfish) -
NCBI
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_021386.3. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_021386.4 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145504.1 and BG083098.2. On Aug 6, 2010 this sequence version replaced NM_016887.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
DEFINITION Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. ACCESSION NM_001193619 VERSION NM_001193619.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL596185.12. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
note="upstream in-frame stop codon" CDS 481..1200 /gene="Cldn14" /codon_start=1 /product="claudin-14" /protein_id="NP_001013447.1" /db_xref="GeneID:304073" /db_xref="RGD:1309165" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEGPYRPYQPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 547..1023 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE 1...
CDS 349..1041 /gene="Cldn2" /gene_synonym="RGD1560247" /codon_start=1 /product="claudin-2" /protein_id="NP_001100316.1" /db_xref="GeneID:300920" /db_xref="RGD:1560247" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV" misc_feature 361..891 /gene="Cldn2" /gene_synonym="RGD1560247" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN // REFERENCE 1...
CDS 132..791 /gene="Cldn6" /codon_start=1 /product="claudin-6 precursor" /protein_id="NP_001095834.1" /db_xref="GeneID:287098" /db_xref="RGD:1308837" /translation="MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLIVLLGLLLYLAGAKCTTCVEDKNSKSRLVLISGVIFVISGVLTLIPICWTAHAIIQDFYNPLVADAQKRELGASLYLGWAASGLLLIGGGLLCCACSSGGTQGPSHYVARYSSPVPHSRGPSEYPSKNYV" sig_peptide 132..194 /gene="Cldn6" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 141..641 /gene="Cldn6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
B. TITLE Parathyroid hormone controls paracellular Ca(2+) transport in the thick ascending limb by regulating the tight-junction protein Claudin14 JOURNAL Proc Natl Acad Sci U S A 114 (16), E3344-E3353 (2017) PUBMED 28373577 REMARK GeneRIF: High Cldn14 is associated with hypoparathyroidism. REFERENCE 6 (bases 1 to 1456) AUTHORS Elkouby-Naor L, Abassi Z, Lagziel A, Gow A and Ben-Yosef T. TITLE Double gene deletion reveals lack of cooperation between claudin 11 and claudin 14 tight junction proteins JOURNAL Cell Tissue Res 333 (3), 427-438 (2008) PUBMED 18663477 REMARK GeneRIF: We generated...
product="claudin-17" /protein_id="NP_001104000.1" /db_xref="GeneID:100001934" /db_xref="ZFIN:ZDB-GENE-070821-2" /translation="MVQGPCDVIALCLSLIGLIGVATVTALPMWRVTAFIGENIIVMETRWEGLWMNCYRQANIRMQCKVYDSLLYLPPDLQAARGLTCCSLALCGFGIIVSLFGLRCMSCLSDQPRNKSIILMITGIIEILASFCIVIPVSWTAHTIIRDFYNPLLLDAQRRELGEALYIGWVTSAFLLASGVIFLCRRVDSNEQPFYARPPRNKQVPNHFQTFNSIRRQPLLQNNSFSTPQHSSAAFSFAVTPSSGQYSQHNVQPVVNGSLIYSPNMIPPQRVNYNGQNVMQSQILASNSQHPVSDPRDSFNTGSAFHPVQQNPLYVGYNYSRVQSGSSNSSTGLRI" misc_feature 270..779 /gene="cldn8.3" /gene_synonym="cldn17; cldn8c; zgc:173444" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: cldn17; cldn8c; zgc:173444
NM_001110530.1 -
Danio rerio (zebrafish) -
NCBI -
UCSC
B. TITLE Parathyroid hormone controls paracellular Ca(2+) transport in the thick ascending limb by regulating the tight-junction protein Claudin14 JOURNAL Proc Natl Acad Sci U S A 114 (16), E3344-E3353 (2017) PUBMED 28373577 REMARK GeneRIF: High Cldn14 is associated with hypoparathyroidism. REFERENCE 6 (bases 1 to 1283) AUTHORS Elkouby-Naor L, Abassi Z, Lagziel A, Gow A and Ben-Yosef T. TITLE Double gene deletion reveals lack of cooperation between claudin 11 and claudin 14 tight junction proteins JOURNAL Cell Tissue Res 333 (3), 427-438 (2008) PUBMED 18663477 REMARK GeneRIF: We generated...
DEFINITION Mus musculus claudin 12 (Cldn12), transcript variant 3, mRNA. ACCESSION NM_001193660 VERSION NM_001193660.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY012969.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane...
musculus claudin 12 (Cldn12), transcript variant 4, mRNA. ACCESSION NM_001193661 VERSION NM_001193661.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY018558.1, AK166110.1, AK128999.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral...
musculus claudin 12 (Cldn12), transcript variant 2, mRNA. ACCESSION NM_001193659 VERSION NM_001193659.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB845860.1, AK039672.1, AK128999.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral...
zgc:136892" /note="claudin 30d" /codon_start=1 /product="uncharacterized protein LOC678612 homolog" /protein_id="NP_001316220.1" /db_xref="GeneID:108278543" /translation="MASQGIHLLGSILALLGWVGVLLSCIIPMWRVTSFMGATIVTSEIIWEGIWMNCVVQSTGQMQCDPYDSMLVLNSDLKAAQVLTVASLLTGSLGIILAFIGGKYTRFLDYSSGAAKDRVATAAGVTLIISALLCLIPVTWAAVAVIQIFYNPQIIDAQRREIGAAIYIGWGASILLLLGGGMLCSTSCSQKAEDDSPLVNYRFVRSSGAGSSIRSSRHIRLHSPSQNRKILVRSDGASVNHHKTTSEGSKKSKTSTTKSEEPMIEPERSDGPSTKSQLNHLGSDHSLGSSESEVASSCPEKTYI" misc_feature 218..727 /gene="cldn30" /gene_synonym="CLDN30d; zgc:136892" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: CLDN30d; zgc:136892
NM_001329291.1 -
Ictalurus punctatus (channel catfish) -
NCBI
LOCUS NM_001016851 2983 bp mRNA linear VRT 23-DEC-2019 DEFINITION Xenopus tropicalis claudin 12 (cldn12), mRNA. ACCESSION NM_001016851 NM_001015839 VERSION NM_001016851.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CR855430.2. On or before Oct 7, 2010 this sequence...
Synonym:
claudin-12
NM_001016851.2 -
Xenopus tropicalis (tropical clawed frog) -
NCBI
gene="Cldn34c2" /gene_synonym="EG625591; Gm6604" /codon_start=1 /product="claudin 34C2" /protein_id="NP_001365203.1" /db_xref="GeneID:625591" /db_xref="MGI:MGI:3644765" /translation="MVLLNKSANHQIRGFTLATIACIMCNTSMALPEWRICYLNNSMLSYPSLAFVNIWEAYICHHNHNSSHLRDCHYYTCHNNLVPLDIRVSQILLLVANVVGLVGTVCSVFALQQLYTEELHKNNDYNPFVLSAVLNAIASTFIFLAVMCNHLSVPSKEEVSFLQSFQMPIFSNAQRAGRAMGLAYISAILFLLSAIIFISYCPSMEIKMFPRV" misc_feature 280..777 /gene="Cldn34c2" /gene_synonym="EG625591; Gm6604" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:389833" ORIGIN // REFERENCE 1...
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK036780.1 and CK626537.1. On Aug 3, 2010 this sequence version replaced NM_016674.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY138805.1, AK128999.1 and AC068663.5. On Aug 14, 2009 this sequence version replaced NM_022890.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
cld-7" /codon_start=1 /product="claudin-7 precursor" /protein_id="NP_113890.1" /db_xref="GeneID:65132" /db_xref="RGD:68432" /translation="MANSGLQLLGFSMAMLGWVGLIASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTGMMSCKMYDSVLALPAATQATRALMIVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMTGGIIFIVAGLAALVACSWIGHQIVTDFYNPLTPMNIKYEFGPAIFIGWAGSALVLLGGALLSCSCPGSESKAAYRAPRSYPKSNSSKEYV" sig_peptide 400..471 /gene="Cldn7" /gene_synonym="cld-7" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 409..912 /gene="Cldn7" /gene_synonym="cld-7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /...
B. TITLE Parathyroid hormone controls paracellular Ca(2+) transport in the thick ascending limb by regulating the tight-junction protein Claudin14 JOURNAL Proc Natl Acad Sci U S A 114 (16), E3344-E3353 (2017) PUBMED 28373577 REMARK GeneRIF: High Cldn14 is associated with hypoparathyroidism. REFERENCE 6 (bases 1 to 1475) AUTHORS Elkouby-Naor L, Abassi Z, Lagziel A, Gow A and Ben-Yosef T. TITLE Double gene deletion reveals lack of cooperation between claudin 11 and claudin 14 tight junction proteins JOURNAL Cell Tissue Res 333 (3), 427-438 (2008) PUBMED 18663477 REMARK GeneRIF: We generated...
S, Rausch V, Blasig R, Richter M, Sporbert A, Wolburg H, Blasig IE and Haseloff RF. TITLE Tight junction proteins at the blood-brain barrier: far more than claudin-5 JOURNAL Cell Mol Life Sci 76 (10), 1987-2002 (2019) PUBMED 30734065 REFERENCE 3 (bases 1 to 3223) AUTHORS Volksdorf T, Heilmann J, Eming SA, Schawjinski K, Zorn-Kruppa M, Ueck C, Vidal-Y-Sy S, Windhorst S, Jucker M, Moll I and Brandner JM. TITLE Tight Junction Proteins Claudin-1 and Occludin Are Important for Cutaneous Wound Healing JOURNAL Am J Pathol 187 (6), 1301-1312 (2017) PUBMED 28412298 REFERENCE 4 (bases 1 to 3223) AUTHORS...
This record has been curated by NCBI staff. The reference sequence was derived from AK312515.1, AK075405.1 and AA973123.1. On Aug 13, 2020 this sequence version replaced NM_001171095.1. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5'...
misc_feature 40..549 /gene="cldn26" /gene_synonym="cldn25-like; si:dkey-98f17.3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" exon 1..663 /gene="cldn26" /gene_synonym="cldn25-like; si:dkey-98f17.3" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 663) AUTHORS Baltzegar DA, Reading BJ, Brune ES and Borski RJ. TITLE Phylogenetic revision of the claudin gene family JOURNAL Mar Genomics 11, 17-26 (2013) PUBMED 23726886...
Synonym: cldn25-like; si:dkey-98f17.3
NM_001122706.1 -
Danio rerio (zebrafish) -
NCBI -
UCSC
ens claudin 15 (CLDN15), transcript variant 1, mRNA. ACCESSION NM_001185080 VERSION NM_001185080.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK056103.1 and DB158141.1. On Aug 13, 2020 this sequence version replaced NM_001185080.1. Summary: This gene encodes a member of the claudin family. Claudins...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK008821.1. On or before Dec 14, 2007 this sequence version replaced XM_908254.2, XM_887785.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 2210404A22Rik; 5330431C14Rik; 9530051B05Rik
NM_029383.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
Data Export:
Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.
Debug Info:
Redirect URI : http://ggrna.dbcls.jp/claudin
lang : en |
div : |
spe : |
query_string : claudin |
format : html |
download :
0.000 | 0.000 | search_start;
0.096 | 0.096 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.201 | 0.105 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.207 | 0.006 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]