GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2021-04-23 23:41:56, GGRNA : RefSeq release 205 (Mar, 2021)



Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (1542 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Nov 23, 2018 this sequence version replaced NM_001307.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.6 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 11 (Cldn11), mRNA. (1872 bp)
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: Claudin-11; Claudin11; Osp; Ot; Otm
NM_008770.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 1 (CLDN1), mRNA. (1237 bp)
gene_synonym="claudin1" /note="upstream in-frame stop codon" CDS 228..863 /gene="CLDN1" /gene_synonym="claudin1" /note="claudin-1 protein" /codon_start=1 /product="claudin-1" /protein_id="NP_001231468.1" /db_xref="GeneID:100625166" /db_xref="VGNC:VGNC:103926" /translation="MANAGLQLLGFILAFLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNTTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 240..746 /gene="CLDN1" /gene_synonym="claudin1" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: claudin1
NM_001244539.1 - Sus scrofa (pig) - NCBI
Rattus norvegicus claudin 19 (Cldn19), mRNA. (1626 bp)
gene="Cldn19" /gene_synonym="claudin-19" /note="upstream in-frame stop codon" CDS 85..720 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19" /protein_id="NP_001008514.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREYV" misc_feature 94..630 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-19
NM_001008514.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 16 (Cldn16), mRNA. (1173 bp)
claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: claudi; claudin-16; PC; PCLN1
NM_053241.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 19 (Cldn19), transcript variant X1, mRNA. (3577 bp)
xref="RGD:1305000" CDS 413..1087 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19 isoform X1" /protein_id="XP_006238818.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREPVVKLSTSVKGPLGV" misc_feature 422..958 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
Synonym: claudin-19
XM_006238756.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Danio rerio claudin 7b (cldn7b), mRNA. (1950 bp)
cb388; claudin7; cld; cldn7; fd19f08; wu:fd19f08" /note="claudin-like protein ZF4A22; claudin-7" /codon_start=1 /product="claudin-7-B" /protein_id="NP_571712.1" /db_xref="GeneID:60635" /db_xref="ZFIN:ZDB-GENE-001103-5" /translation="MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTGQQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAMTGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGGMLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV" misc_feature 165..701 /gene="cldn7b" /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08; wu:fd19f08" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: cb388; claudin7; cld; cldn7; fd19f08; wu:fd19f08
NM_131637.1 - Danio rerio (zebrafish) - NCBI - UCSC
Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC003688.1, AJ011497.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185022.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1457 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185023.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Canis lupus familiaris claudin 2 (CLDN2), mRNA. (953 bp)
membrane protein claudin-2" /codon_start=1 /product="claudin-2" /protein_id="NP_001003089.1" /db_xref="GeneID:403649" /db_xref="VGNC:VGNC:39316" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVVGGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 80..142 /gene="CLDN2" /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1); transmembrane region" misc_feature 125..601 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin...
NM_001003089.1 - Canis lupus familiaris (dog) - NCBI
Rattus norvegicus claudin 18 (Cldn18), mRNA. (1574 bp)
note="claudin 18-like" /codon_start=1 /product="claudin-18 precursor" /protein_id="NP_001014118.1" /db_xref="GeneID:315953" /db_xref="RGD:1359696" /translation="MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVQQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLTSGIMFIISGVCAIIGVSVFANMLVTNFWMSTANMYSGMGGMVQTVQTRYTFGAALFVGWIAGGLTLIGGVMMCIACRGLTPDDRNFKAVSYHASGQNVAYKPGGFKASTGFGSNARNKKIYDGGARTEDDEQSHPTKYDYV" sig_peptide 33..101 /gene="Cldn18" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature <159..605 /gene="Cldn18" /note="PMP-22/EMP/MP20/Claudin family;...
NM_001014096.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. (1035 bp)
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160098.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v2, mRNA. (1092 bp)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160097.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. (1143 bp)
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160096.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. (852 bp)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_001160099.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 19 (CLDN19), transcript variant 3, mRNA. (3499 bp)
is encoded by transcript variant 3" /codon_start=1 /product="claudin-19 isoform c" /protein_id="NP_001172046.1" /db_xref="CCDS:CCDS53306.1" /db_xref="GeneID:149461" /db_xref="HGNC:HGNC:2040" /db_xref="MIM:610036" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGMNLAQPCSWAGPQLAWPCWAAPSSAAHARSQRDPTAAHSPIGLDPLLLPESTSELRLPWPAPHPVAPLPSIQPASQHPGQGHWGIGWA" misc_feature 183..>590 /gene="CLDN19" /gene_synonym="HOMG5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
Synonym: HOMG5
NM_001185117.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant a, mRNA. (1200 bp)
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_023878.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 3 (Cldn3), mRNA. (1501 bp)
stop codon" CDS 441..1100 /gene="Cldn3" /note="RVP1; ventral prostate.1 protein" /codon_start=1 /product="claudin-3" /protein_id="NP_113888.2" /db_xref="GeneID:65130" /db_xref="RGD:68425" /translation="MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVAGVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALLCCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV" misc_feature 447..941 /gene="Cldn3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" misc_feature 465..527 /gene="Cldn3" /note="...
NM_031700.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin 15a (cldn15a), mRNA. (1474 bp)
Data-START## Transcript exon combination :: KM870792.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1474 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="7" /map="7" gene 1..1474 /gene="cldn15a" /gene_synonym="Claudin-15; cldn15" /note="claudin 15a" /db_xref="GeneID:108267636" misc_feature 222..224 /gene="cldn15a" /gene_synonym="Claudin-15; cldn15" /note="upstream in-frame stop codon" CDS 282..953 /gene="cldn15a" /gene_synonym="Claudin-15; cldn15" /note="claudin 15" /codon_start=1 /product="claudin-15" /protein_id="NP...
Synonym: Claudin-15; cldn15
NM_001329306.1 - Ictalurus punctatus (channel catfish) - NCBI
Mus musculus claudin 17 (Cldn17), mRNA. (1172 bp)
musculus claudin 17 (Cldn17), mRNA. ACCESSION NM_181490 VERSION NM_181490.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK048287.1. On Apr 5, 2007 this sequence version replaced NM_181490.2. Summary: This gene encodes a member of the claudin family. Claudins are...
NM_181490.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin 15-like b (cldn15lb), mRNA. (1765 bp)
single sample supports all introns SAMN00774075 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1765 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="17" /map="17" gene 1..1765 /gene="cldn15lb" /gene_synonym="Claudin-10; cldn1; CLDN10; CLDN26" /note="claudin 15-like b" /db_xref="GeneID:108278410" exon 1..879 /gene="cldn15lb" /gene_synonym="Claudin-10; cldn1; CLDN10; CLDN26" /inference="alignment:Splign:2.1.0" misc_feature 810..812 /gene="cldn15lb" /gene_synonym="Claudin-10; cldn1; CLDN10; CLDN26" /note="upstream in-frame stop codon...
Synonym: Claudin-10; cldn1; CLDN10; CLDN26
NM_001329305.1 - Ictalurus punctatus (channel catfish) - NCBI
Xenopus tropicalis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) (cldn5), mRNA. (2593 bp)
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1; claudin-5; cpetrl1; tmvcf
NM_001006706.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus tropicalis claudin 8, gene 4 (cldn8.4), mRNA. (2062 bp)
gene_synonym="claudin-8" /inference="alignment:Splign:2.0.8" CDS 31..711 /gene="cldn8.4" /gene_synonym="claudin-8" /codon_start=1 /product="claudin 8, gene 2" /protein_id="NP_001120297.1" /db_xref="GeneID:100145356" /db_xref="Xenbase:XB-GENE-991592" /translation="MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV" misc_feature 31..567 /gene="cldn8.4" /gene_synonym="claudin-8" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: claudin-8
NM_001126825.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus tropicalis claudin 1 (cldn1), mRNA. (2770 bp)
CDS 152..787 /gene="cldn1" /gene_synonym="claudin-1; cld1; ilvasc; semp1" /note="Xclaudin 1" /codon_start=1 /product="claudin-1" /protein_id="NP_001015704.1" /db_xref="GeneID:548421" /db_xref="Xenbase:XB-GENE-951609" /translation="MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKTYDSLLKLDSTMQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGNKIAKDFYNVFTPTNSKYEFGPALFIGWAGAALAILGGALLCCSCPRRETSYPPPRGYNKSAPPAGKDYV" misc_feature 164..697 /gene="cldn1" /gene_synonym="claudin-1; cld1; ilvasc; semp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: claudin-1; cld1; ilvasc; semp1
NM_001015704.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Ictalurus punctatus claudin 26 (cldn26), mRNA. (1510 bp)
synonym="CLDN33c; si:dkey-98f17.3" /note="claudin 33c; putative claudin-24" /codon_start=1 /product="uncharacterized protein LOC793143 homolog" /protein_id="NP_001316176.1" /db_xref="GeneID:108255719" /translation="MYRERKEPELTMVLLTTKIVQRASLFVAFGGLVTTFITTFLPLWKTMNSELNEMENWYEGLWHMCIFTEEVGLHCKAFESLLALPPVTLASRILMCVSIATGFLGVLAAFFGLDGVEIGAGRDRLKRGLLILGGVLIWVSGLTTLAPVSLIAYVMVVEFWDGGLPDVMPRWEYGEAMFSAWFSGLLLVIGGSFIFVAVCMRDHEEKQQREIFSPAHELQPRTQHYLKTEVL" misc_feature 727..1227 /gene="cldn26" /gene_synonym="CLDN33c; si:dkey-98f17.3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: CLDN33c; si:dkey-98f17.3
NM_001329247.1 - Ictalurus punctatus (channel catfish) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant b, mRNA. (960 bp)
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_021386.3. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn; Cldn1; Cldn10a; Cldn10b; D14Ertd728; D14Ertd728e
NM_021386.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 7 (Cldn7), transcript variant 1, mRNA. (1311 bp)
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145504.1 and BG083098.2. On Aug 6, 2010 this sequence version replaced NM_016887.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
NM_016887.6 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. (989 bp)
DEFINITION Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. ACCESSION NM_001193619 VERSION NM_001193619.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL596185.12. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
NM_001193619.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 14 (Cldn14), mRNA. (1549 bp)
note="upstream in-frame stop codon" CDS 481..1200 /gene="Cldn14" /codon_start=1 /product="claudin-14" /protein_id="NP_001013447.1" /db_xref="GeneID:304073" /db_xref="RGD:1309165" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEGPYRPYQPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 547..1023 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE 1...
NM_001013429.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 2 (Cldn2), mRNA. (3052 bp)
CDS 349..1041 /gene="Cldn2" /gene_synonym="RGD1560247" /codon_start=1 /product="claudin-2" /protein_id="NP_001100316.1" /db_xref="GeneID:300920" /db_xref="RGD:1560247" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV" misc_feature 361..891 /gene="Cldn2" /gene_synonym="RGD1560247" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" ORIGIN // REFERENCE 1...
Synonym: RGD1560247
NM_001106846.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 6 (Cldn6), mRNA. (1544 bp)
CDS 132..791 /gene="Cldn6" /codon_start=1 /product="claudin-6 precursor" /protein_id="NP_001095834.1" /db_xref="GeneID:287098" /db_xref="RGD:1308837" /translation="MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLIVLLGLLLYLAGAKCTTCVEDKNSKSRLVLISGVIFVISGVLTLIPICWTAHAIIQDFYNPLVADAQKRELGASLYLGWAASGLLLIGGGLLCCACSSGGTQGPSHYVARYSSPVPHSRGPSEYPSKNYV" sig_peptide 132..194 /gene="Cldn6" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 141..641 /gene="Cldn6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
NM_001102364.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 14 (Cldn14), transcript variant 3, mRNA. (1456 bp)
B. TITLE Parathyroid hormone controls paracellular Ca(2+) transport in the thick ascending limb by regulating the tight-junction protein Claudin14 JOURNAL Proc Natl Acad Sci U S A 114 (16), E3344-E3353 (2017) PUBMED 28373577 REMARK GeneRIF: High Cldn14 is associated with hypoparathyroidism. REFERENCE 6 (bases 1 to 1456) AUTHORS Elkouby-Naor L, Abassi Z, Lagziel A, Gow A and Ben-Yosef T. TITLE Double gene deletion reveals lack of cooperation between claudin 11 and claudin 14 tight junction proteins JOURNAL Cell Tissue Res 333 (3), 427-438 (2008) PUBMED 18663477 REMARK GeneRIF: We generated...
Synonym: AI851731
NM_001165926.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Danio rerio claudin 8.3 (cldn8.3), mRNA. (1313 bp)
Synonym: cldn17; cldn8c; zgc:173444
NM_001110530.1 - Danio rerio (zebrafish) - NCBI - UCSC
Mus musculus claudin 14 (Cldn14), transcript variant 2, mRNA. (1283 bp)
B. TITLE Parathyroid hormone controls paracellular Ca(2+) transport in the thick ascending limb by regulating the tight-junction protein Claudin14 JOURNAL Proc Natl Acad Sci U S A 114 (16), E3344-E3353 (2017) PUBMED 28373577 REMARK GeneRIF: High Cldn14 is associated with hypoparathyroidism. REFERENCE 6 (bases 1 to 1283) AUTHORS Elkouby-Naor L, Abassi Z, Lagziel A, Gow A and Ben-Yosef T. TITLE Double gene deletion reveals lack of cooperation between claudin 11 and claudin 14 tight junction proteins JOURNAL Cell Tissue Res 333 (3), 427-438 (2008) PUBMED 18663477 REMARK GeneRIF: We generated...
Synonym: AI851731
NM_001165925.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 3, mRNA. (3752 bp)
DEFINITION Mus musculus claudin 12 (Cldn12), transcript variant 3, mRNA. ACCESSION NM_001193660 VERSION NM_001193660.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY012969.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane...
NM_001193660.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 4, mRNA. (3639 bp)
musculus claudin 12 (Cldn12), transcript variant 4, mRNA. ACCESSION NM_001193661 VERSION NM_001193661.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY018558.1, AK166110.1, AK128999.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001193661.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 2, mRNA. (3804 bp)
musculus claudin 12 (Cldn12), transcript variant 2, mRNA. ACCESSION NM_001193659 VERSION NM_001193659.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB845860.1, AK039672.1, AK128999.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001193659.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin 30 (cldn30), mRNA. (1338 bp)
Synonym: CLDN30d; zgc:136892
NM_001329291.1 - Ictalurus punctatus (channel catfish) - NCBI
Xenopus tropicalis claudin 12 (cldn12), mRNA. (2983 bp)
LOCUS NM_001016851 2983 bp mRNA linear VRT 23-DEC-2019 DEFINITION Xenopus tropicalis claudin 12 (cldn12), mRNA. ACCESSION NM_001016851 NM_001015839 VERSION NM_001016851.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CR855430.2. On or before Oct 7, 2010 this sequence...
Synonym: claudin-12
NM_001016851.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Mus musculus claudin 34C2 (Cldn34c2), mRNA. (857 bp)
gene="Cldn34c2" /gene_synonym="EG625591; Gm6604" /codon_start=1 /product="claudin 34C2" /protein_id="NP_001365203.1" /db_xref="GeneID:625591" /db_xref="MGI:MGI:3644765" /translation="MVLLNKSANHQIRGFTLATIACIMCNTSMALPEWRICYLNNSMLSYPSLAFVNIWEAYICHHNHNSSHLRDCHYYTCHNNLVPLDIRVSQILLLVANVVGLVGTVCSVFALQQLYTEELHKNNDYNPFVLSAVLNAIASTFIFLAVMCNHLSVPSKEEVSFLQSFQMPIFSNAQRAGRAMGLAYISAILFLLSAIIFISYCPSMEIKMFPRV" misc_feature 280..777 /gene="Cldn34c2" /gene_synonym="EG625591; Gm6604" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:389833" ORIGIN // REFERENCE 1...
Synonym: EG625591; Gm6604
NM_001378274.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 1 (Cldn1), mRNA. (3263 bp)
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK036780.1 and CK626537.1. On Aug 3, 2010 this sequence version replaced NM_016674.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: AI596271
NM_016674.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 12 (Cldn12), transcript variant 1, mRNA. (3794 bp)
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY138805.1, AK128999.1 and AC068663.5. On Aug 14, 2009 this sequence version replaced NM_022890.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
NM_022890.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 7 (Cldn7), mRNA. (1215 bp)
cld-7" /codon_start=1 /product="claudin-7 precursor" /protein_id="NP_113890.1" /db_xref="GeneID:65132" /db_xref="RGD:68432" /translation="MANSGLQLLGFSMAMLGWVGLIASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTGMMSCKMYDSVLALPAATQATRALMIVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMTGGIIFIVAGLAALVACSWIGHQIVTDFYNPLTPMNIKYEFGPAIFIGWAGSALVLLGGALLSCSCPGSESKAAYRAPRSYPKSNSSKEYV" sig_peptide 400..471 /gene="Cldn7" /gene_synonym="cld-7" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 409..912 /gene="Cldn7" /gene_synonym="cld-7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; pfam00822" /...
Synonym: cld-7
NM_031702.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 14 (Cldn14), transcript variant 1, mRNA. (1475 bp)
B. TITLE Parathyroid hormone controls paracellular Ca(2+) transport in the thick ascending limb by regulating the tight-junction protein Claudin14 JOURNAL Proc Natl Acad Sci U S A 114 (16), E3344-E3353 (2017) PUBMED 28373577 REMARK GeneRIF: High Cldn14 is associated with hypoparathyroidism. REFERENCE 6 (bases 1 to 1475) AUTHORS Elkouby-Naor L, Abassi Z, Lagziel A, Gow A and Ben-Yosef T. TITLE Double gene deletion reveals lack of cooperation between claudin 11 and claudin 14 tight junction proteins JOURNAL Cell Tissue Res 333 (3), 427-438 (2008) PUBMED 18663477 REMARK GeneRIF: We generated...
Synonym: AI851731
NM_019500.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 1 (Cldn1), mRNA. (3223 bp)
S, Rausch V, Blasig R, Richter M, Sporbert A, Wolburg H, Blasig IE and Haseloff RF. TITLE Tight junction proteins at the blood-brain barrier: far more than claudin-5 JOURNAL Cell Mol Life Sci 76 (10), 1987-2002 (2019) PUBMED 30734065 REFERENCE 3 (bases 1 to 3223) AUTHORS Volksdorf T, Heilmann J, Eming SA, Schawjinski K, Zorn-Kruppa M, Ueck C, Vidal-Y-Sy S, Windhorst S, Jucker M, Moll I and Brandner JM. TITLE Tight Junction Proteins Claudin-1 and Occludin Are Important for Cutaneous Wound Healing JOURNAL Am J Pathol 187 (6), 1301-1312 (2017) PUBMED 28412298 REFERENCE 4 (bases 1 to 3223) AUTHORS...
NM_031699.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 2 (CLDN2), transcript variant 3, mRNA. (2921 bp)
This record has been curated by NCBI staff. The reference sequence was derived from AK312515.1, AK075405.1 and AA973123.1. On Aug 13, 2020 this sequence version replaced NM_001171095.1. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5'...
NM_001171095.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Danio rerio claudin 26 (cldn26), mRNA. (663 bp)
misc_feature 40..549 /gene="cldn26" /gene_synonym="cldn25-like; si:dkey-98f17.3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" exon 1..663 /gene="cldn26" /gene_synonym="cldn25-like; si:dkey-98f17.3" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 663) AUTHORS Baltzegar DA, Reading BJ, Brune ES and Borski RJ. TITLE Phylogenetic revision of the claudin gene family JOURNAL Mar Genomics 11, 17-26 (2013) PUBMED 23726886...
Synonym: cldn25-like; si:dkey-98f17.3
NM_001122706.1 - Danio rerio (zebrafish) - NCBI - UCSC
Homo sapiens claudin 15 (CLDN15), transcript variant 1, mRNA. (2129 bp)
ens claudin 15 (CLDN15), transcript variant 1, mRNA. ACCESSION NM_001185080 VERSION NM_001185080.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK056103.1 and DB158141.1. On Aug 13, 2020 this sequence version replaced NM_001185080.1. Summary: This gene encodes a member of the claudin family. Claudins...
NM_001185080.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 22 (Cldn22), mRNA. (994 bp)
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK008821.1. On or before Dec 14, 2007 this sequence version replaced XM_908254.2, XM_887785.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 2210404A22Rik; 5330431C14Rik; 9530051B05Rik
NM_029383.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.096 | 0.096 | count_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.201 | 0.105 | search_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.207 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]