GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2017-03-23 09:12:08, GGRNA : RefSeq release 80 (Jan, 2017)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Sus scrofa claudin 2 (CLDN2), mRNA. (954 bp)
CLDN2" /note="claudin 2" /db_xref="GeneID:733684" misc_feature 52..54 /gene="CLDN2" /note="upstream in-frame stop codon" CDS 136..828 /gene="CLDN2" /codon_start=1 /product="claudin-2" /protein_id="NP_001155110.1" /db_xref="GI:239504584" /db_xref="GeneID:733684" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTMLGLPADIQAAQAMMVTSSAISSLACIITVVGMRCTVFCQNSRAKDRVAVVGGVFFLLGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCPLQGNRSNYYDAYQAQPLATRSSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 202..678 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
NM_001161638.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 1-like (LOC396566), mRNA. (1012 bp)
a" /replace="t" /db_xref="dbSNP:81402566" CDS 175..810 /gene="LOC396566" /codon_start=1 /product="claudin-1-like" /protein_id="NP_001155107.1" /db_xref="GI:239504560" /db_xref="GeneID:396566" /translation="MANAGLQLLGFILAFLGWIGSIVSTALLQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATARYGNRIVQEFYHLMTPVNARYEFGQALFTGWAAASLCLLGGALLCRSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 187..693 /gene="LOC396566" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE 1 (bases 1 to 1012) AUTHORS...
NM_001161635.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 6 (CLDN6), mRNA. (746 bp)
chromosome="3" /map="3" gene 1..746 /gene="CLDN6" /note="claudin 6" /db_xref="GeneID:100302020" CDS 19..684 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="NP_001155117.1" /db_xref="GI:239504574" /db_xref="GeneID:100302020" /translation="MASAGLQILGIVLTLFGWVNALVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLSGAKCTTCVEDKDTKARLVLTSGIIFVLSGVLTLIPVCWTAHAIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGRSQGSSHYMARYSASAPHTASRGPSEYPTKNYV" misc_feature 31..528 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
NM_001161645.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 15 (CLDN15), mRNA. (995 bp)
taxon:9823" gene 1..995 /gene="CLDN15" /note="claudin 15" /db_xref="GeneID:100302018" CDS 206..910 /gene="CLDN15" /codon_start=1 /product="claudin-15" /protein_id="NP_001155115.1" /db_xref="GI:239504570" /db_xref="GeneID:100302018" /translation="MSVAVEIFGFFMAALGLVLLGVTLPHSSWRVSTVHGNVITTNTIFENLWYSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLFLGMVGLRCTNIGGLELSRKTKLAATAGALHILAGVCGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWTASLLSILGGICLCSSCCCAQDDDPAANVRVPYKAPMPASSLTARLPAVASDEDGDSSFGKYGKNAYV" misc_feature 290..736 /gene="CLDN15" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="...
NM_001161643.1 - Sus scrofa (pig) - NCBI
Salmo salar Claudin-like protein ZF-A89 (cldy), mRNA. (1517 bp)
LOCUS NM_001141277 1517 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-like protein ZF-A89 (cldy), mRNA. ACCESSION NM_001141277 VERSION NM_001141277.1 GI:213512044 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT048904.1. ##Evidence-Data-START##...
NM_001141277.1 - Salmo salar (Atlantic salmon) - NCBI
Oryctolagus cuniculus claudin 12 (CLDN12), mRNA. (735 bp)
LOCUS NM_001171276 735 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus claudin 12 (CLDN12), mRNA. ACCESSION NM_001171276 VERSION NM_001171276.1 GI:284005340 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae; Oryctolagus. COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from DP000945.1. FEATURES...
NM_001171276.1 - Oryctolagus cuniculus (rabbit) - NCBI
Oncorhynchus mykiss claudin 30 (LOC100642186), mRNA. (627 bp)
taxon:8022" gene 1..627 /gene="LOC100642186" /note="claudin 30" /db_xref="GeneID:100642186" CDS 1..627 /gene="LOC100642186" /codon_start=1 /product="claudin 30" /protein_id="NP_001233202.1" /db_xref="GI:350538221" /db_xref="GeneID:100642186" /translation="MASAGFQMLGTALGIIGWIGAIVVCALPQWKVTAFIGENIITAQTTWQGIWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALIIISIMMGLVGILLSVAGGKCTNCVEDERAKSRIGVGSGVVFIIAGILCLIPVCWSANTIIRDFYNPMLMSSQKMELGAALYIGWGAAALMIMGGGFLCANCPPKEDNYPTKYSAARSTAPKDYV" misc_feature 13..543 /gene="LOC100642186" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
NM_001246273.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Salmo salar Claudin-14 (cld14), mRNA. (1872 bp)
LOCUS NM_001140323 1872 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-14 (cld14), mRNA. ACCESSION NM_001140323 VERSION NM_001140323.1 GI:213515035 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT045650.1. ##Evidence-Data-START## Transcript exon...
NM_001140323.1 - Salmo salar (Atlantic salmon) - NCBI
Papio anubis claudin 12 (CLDN12), mRNA. (735 bp)
LOCUS NM_001168990 735 bp mRNA linear PRI 11-SEP-2012 DEFINITION Papio anubis claudin 12 (CLDN12), mRNA. ACCESSION NM_001168990 VERSION NM_001168990.1 GI:281183134 KEYWORDS RefSeq. SOURCE Papio anubis (olive baboon) ORGANISM Papio anubis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Papio. COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from DP000509.1....
NM_001168990.1 - Papio anubis (olive baboon) - NCBI
PREDICTED: Tursiops truncatus claudin 7 (CLDN7), mRNA. (555 bp)
includes similarity to: 26 Proteins" /db_xref="GeneID:101323757" CDS 1..555 /gene="CLDN7" /codon_start=1 /product="claudin-7" /protein_id="XP_004326143.1" /db_xref="GI:470643137" /db_xref="GeneID:101323757" /translation="MANSGLQLLGFSMALLGWVGLVACTAIPQWQVSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALPAALQATRALMKVKKARTAMAGGIIFILAGLAALIACSWYGHQIVTDFYNPLVPMNVKYEFGPAIFIGWAGSALVLLGGALLSCSCPGSESKVGYRAPRSYPKPNSAKEYV" misc_feature 10..432 /gene="CLDN7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004326095.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 9 (CLDN9), mRNA. (654 bp)
to: 30 Proteins" /db_xref="GeneID:101320849" CDS 1..654 /gene="CLDN9" /codon_start=1 /product="claudin-9" /protein_id="XP_004321703.1" /db_xref="GI:470630195" /db_xref="GeneID:101320849" /translation="MASAALELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTGGVILLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAASALLMLGGGLLCCTCPPPQIDRPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 13..516 /gene="CLDN9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004321655.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 10 (CLDN10), partial mRNA. (486 bp)
evidence includes similarity to: 8 Proteins" /db_xref="GeneID:101333721" CDS <1..486 /gene="CLDN10" /codon_start=1 /product="claudin-10" /protein_id="XP_004311502.1" /db_xref="GI:470597741" /db_xref="GeneID:101333721" /translation="IAGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKPKGFFPTYVNLLFLLLCLIGTVQEVSRLPELNQFSRAGMGYTYNGATSIMSSRTKYHGGEDFKTTNPSKQFDKNAYV" misc_feature <4..240 /gene="CLDN10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004311454.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 18 (CLDN18), mRNA. (675 bp)
to: 9 Proteins" /db_xref="GeneID:101332818" CDS 1..675 /gene="CLDN18" /codon_start=1 /product="claudin-18" /protein_id="XP_004323153.1" /db_xref="GI:470635248" /db_xref="GeneID:101332818" /translation="MSTTTCQVVGFLLSMLGLAGCITATVMDTWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGFTQCRPYFTILGLPAMLQAVRALMIVGIVLSIIGLLVSIFALKCIRIGGMDDSAKAKMTLTSGIMFIISGLCAIAGVSVFANMLVTNFWMSTANMYTSMGGMVQTVQTSYKAVSYHASGHNVAYRPGGFKASTVFESNTKNKKIYDGGARTEDEGQSHPSKYDYV" misc_feature 19..>441 /gene="CLDN18" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004323105.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin domain containing 2 (CLDND2), mRNA. (536 bp)
similarity to: 3 mRNAs, 3 Proteins" /db_xref="GeneID:101318753" CDS 1..501 /gene="CLDND2" /codon_start=1 /product="claudin domain-containing protein 2" /protein_id="XP_004328064.1" /db_xref="GI:470649070" /db_xref="GeneID:101318753" /translation="MGVKRSLQSGGTLLGFLANILTILSMATNYWIRYSGGHSGLWQECSGGTCSNISCQTMLAVTGACMVLAAGCSIVGLVMGLRILCQEGDSRGRTTSAIFFLCGLLQLIALTGYTVKNAGKNDVFFSWSCFSGWLALPFSVLAGFCFLLADMIMQSTDAISGFPVCL" misc_feature 28..429 /gene="CLDND2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004328016.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 6 (CLDN6), mRNA. (1316 bp)
mRNAs, 25 Proteins" /db_xref="GeneID:101320557" CDS 27..692 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="XP_004321702.1" /db_xref="GI:470630192" /db_xref="GeneID:101320557" /translation="MASAGLQILGIVLTLLGWVNALVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLAGAKCTTCVEDKDSKARLVLISGIIFVISGVLTLIPVCWTAHTIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGSSHYMARYSASAPHTASRGPSEYPTKNYV" misc_feature 39..536 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004321654.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 20 (CLDN20), mRNA. (725 bp)
mRNAs, 2 Proteins" /db_xref="GeneID:101337259" CDS 22..672 /gene="CLDN20" /codon_start=1 /product="claudin-20" /protein_id="XP_004312510.1" /db_xref="GI:470601271" /db_xref="GeneID:101337259" /translation="MISAGLQLLAFALALTGVSGVLMATLLPNWKVNVDPGSNIITAIVQMQGLWMDCTWYSTGMFSCTLKYSVLALPTHVQAARAAMVLACVLSAVGMCTATIGMKCIRLGGDRETKSYACFAGGVCLISAGISSLIPTVWYTKEIIANFVDVAVPESNKHEPGGAVYIGFISAMLLFISGMIFCIKKDSEAWLHPSKQEHVPTTQPEDRSANSLKDYV" misc_feature <163..564 /gene="CLDN20" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004312462.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Sus scrofa claudin 9 (CLDN9), mRNA. (1178 bp)
gene="CLDN9" /note="upstream in-frame stop codon" CDS 209..862 /gene="CLDN9" /codon_start=1 /product="claudin-9" /protein_id="NP_001155119.1" /db_xref="GI:239504578" /db_xref="GeneID:100302022" /translation="MASAGLELLGMSLAVLGWLGTLVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCAVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVVLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAASALLMLGGGLLCCTCPPPQIDRPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 221..724 /gene="CLDN9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation 243 /gene="CLDN9" /replace="c" /...
NM_001161647.1 - Sus scrofa (pig) - NCBI
PREDICTED: Tursiops truncatus claudin 19 (CLDN19), mRNA. (698 bp)
mRNAs, 10 Proteins" /db_xref="GeneID:101332812" CDS 19..693 /gene="CLDN19" /codon_start=1 /product="claudin-19" /protein_id="XP_004321935.1" /db_xref="GI:470631400" /db_xref="GeneID:101332812" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALEGHIQSARALMVVAVLLGFVAMVLSVIGMKCTRVGDSNPIAKGRVAIAGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFLGWAAAGLAMLGGSFLCCTCQEPERSNSSPQPYRPGPSAAAREPVVKLSASTKGPLGV" misc_feature 28..564 /gene="CLDN19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004321887.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 14 (CLDN14), mRNA. (917 bp)
Proteins" /db_xref="GeneID:101324633" CDS 115..825 /gene="CLDN14" /codon_start=1 /product="claudin-14" /protein_id="XP_004322448.1" /db_xref="GI:470633000" /db_xref="GeneID:101324633" /translation="MASAAVQLMGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQASRALMVISCLLSGVACACAVVGMKCTRCAKGTPAKTTFAVLGGVFFILAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLACQDEAPSRPYQAQPRAGTATAPSYRPPDAYKDNRAPSATSASHNGYRLNDYV" misc_feature 127..657 /gene="CLDN14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004322400.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 4 (CLDN4), mRNA. (1539 bp)
gene="CLDN4" /note="upstream in-frame stop codon" CDS 74..703 /gene="CLDN4" /codon_start=1 /product="claudin-4" /protein_id="XP_004310860.1" /db_xref="GI:470596013" /db_xref="GeneID:101319815" /translation="MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVICIILAVLGVLLSVVGGKCTNCVEDESAKAKTMIVAGVVFLLAGLLVMVPVSWTAHNIIRDFYNPLVASGQKREMGASLYIGWAASGLLMLGGALLCCNCPPRTDKPYSAKYSAARSAPASNYV" misc_feature 83..583 /gene="CLDN4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004310812.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin-22-like (LOC101337537), mRNA. (663 bp)
Proteins" /db_xref="GeneID:101337537" CDS 1..663 /gene="LOC101337537" /codon_start=1 /product="claudin-22-like" /protein_id="XP_004310509.1" /db_xref="GI:470594891" /db_xref="GeneID:101337537" /translation="MALVFRVAMQFVGILLSLLGWVLSIITTFLPHWKNLNLDLNEMENWTVGLWQTCVTQEEVGMQCKDFDSFLALPAELRISRILMFLSNGLGFLGLLVSGFGLDCLRIGERQQDVKKQLLILGGILFWTAGVTALVPVSWVAHRTVQEFWDETIPEIVPRWEFGEALFIGWFAGFSLLLGGCLLNWAACGTQIPLASGHYAVAEMQTQCSYLENGTANPSV" misc_feature 28..549 /gene="LOC101337537" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004310461.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 15 (CLDN15), mRNA. (837 bp)
gene="CLDN15" /note="upstream in-frame stop codon" CDS 226..837 /gene="CLDN15" /codon_start=1 /product="claudin-15" /protein_id="XP_004312367.1" /db_xref="GI:470600820" /db_xref="GeneID:101336398" /translation="MSVAVEIFGFFIAALGLLMLGVTLTHSSWRVSTVHGNVITTSTIFENLWYSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAIFLGFLGLFLGMVGLRCTNIGDLEPSRKTKLAATAGALNILAGNWGQVMGGRCAVVGGRGAGRGLHLPLTRVLSPASIRLPYKAPAMPAKSLAARLPTSASDEEGDSSFGKYGKNAYV" misc_feature 235..>543 /gene="CLDN15" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004312319.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin domain containing 1 (CLDND1), mRNA. (852 bp)
GeneID:101321989" CDS 100..852 /gene="CLDND1" /codon_start=1 /product="claudin domain-containing protein 1" /protein_id="XP_004320115.1" /db_xref="GI:470625694" /db_xref="GeneID:101321989" /translation="MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWTDFASDEADEKTYNDALFRNNGTVGLWRRCITIPQNTYWYSPPERTGISLILTFVSFTYSIIEKVIHGNISFFSLSFLKSDLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPENVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA" misc_feature 148..792 /gene="CLDND1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004320067.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Salmo salar Claudin-5 (cld5), mRNA. (1344 bp)
LOCUS NM_001146383 1344 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-5 (cld5), mRNA. ACCESSION NM_001146383 VERSION NM_001146383.1 GI:226443379 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT056482.1. ##Evidence-Data-START## Transcript exon...
NM_001146383.1 - Salmo salar (Atlantic salmon) - NCBI
PREDICTED: Tursiops truncatus claudin-17-like (LOC101327382), mRNA. (718 bp)
db_xref="GeneID:101327382" CDS 22..699 /gene="LOC101327382" /codon_start=1 /product="claudin-17-like" /protein_id="XP_004331151.1" /db_xref="GI:470658396" /db_xref="GeneID:101327382" /translation="MTFNLLQIAGLVLGFFGMVGTLATALLPQWRVSAFVGSNIIVFERIWEGLWMNCIRQVKVRLQCKFYNSLLALPFDLEAARALMCVAVALSLIALLIGISGMKKTQCKDSNERVKAYLLGTSGVLFILTGIFVLIPVCWTANIIIRDFYNPAVHIGQKRDLGAALFLGWASTAVLFIGGGLLCGYCCCNRKKQKNRYPAAEHPAPHTDKRPQNGTVLSKTSTSYV" misc_feature 34..567 /gene="LOC101327382" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004331103.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin-1-like (LOC101335774), mRNA. (1234 bp)
note="upstream in-frame stop codon" CDS 238..873 /gene="LOC101335774" /codon_start=1 /product="claudin-1-like" /protein_id="XP_004319586.1" /db_xref="GI:470624045" /db_xref="GeneID:101335774" /translation="MANAGLQLLGFILAFLGWIGSIVSTALPQWRIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKIFDSLLNLNSTLQATRALMVIGILLGLVAIFVATIGMKCMKCLEDNEAQKMRMAVIGGVIFLISGLAVLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPQKATSYPTPRPYPKPAPSSGKDYV" misc_feature 250..756 /gene="LOC101335774" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_004319538.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 3 (CLDN3), mRNA. (1244 bp)
gene="CLDN3" /note="upstream in-frame stop codon" CDS 238..900 /gene="CLDN3" /codon_start=1 /product="claudin-3" /protein_id="XP_004310859.1" /db_xref="GI:470596009" /db_xref="GeneID:101319515" /translation="MSMGLEIAGTSLAVMGWLSTIVCCVLPMWRVTAFIGSSIITAQITWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVIAILLAAFGLLVALVGAQCTNCVQDETAKAKITIVAGVLFLMAALLTLVPVSWSANTIIREFYNPLVPDAQKREMGSALYVGWAAAALQLLGGALLCCSCPPREKKYTPAKILYSAPRSNGPGTGTGTAYDRKDYV" misc_feature 244..738 /gene="CLDN3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" STS 238..900 /gene="CLDN3" /standard_name...
XM_004310811.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 5 (CLDN5), mRNA. (877 bp)
mRNAs, 20 Proteins" /db_xref="GeneID:101330910" CDS 94..750 /gene="CLDN5" /codon_start=1 /product="claudin-5" /protein_id="XP_004322070.1" /db_xref="GI:470631816" /db_xref="GeneID:101330910" /translation="MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVGAVLLALVALFVTLAGAQCTTCVAPGPGKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPMSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCAGRPDFGFPVKYSAPRRPTASGDYDKKNYV" misc_feature 106..633 /gene="CLDN5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" STS 124..240 /gene="CLDN5" /standard_name="...
XM_004322022.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 11 (CLDN11), mRNA. (1911 bp)
gene="CLDN11" /note="upstream in-frame stop codon" CDS 210..833 /gene="CLDN11" /codon_start=1 /product="claudin-11" /protein_id="XP_004321705.1" /db_xref="GI:470630201" /db_xref="GeneID:101322479" /translation="MVATFLQIVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVLATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRTGHEPGVAKYRRAQLAGVMLILVALCAMVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVIICCAGDAQSFGENRFYYSSGSSSPTHAKSAHV" misc_feature 225..725 /gene="CLDN11" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" STS 1420..1870 /gene="CLDN11" /standard_name="MARC...
XM_004321657.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin-2-like (LOC101326995), mRNA. (1446 bp)
upstream in-frame stop codon" CDS 178..870 /gene="LOC101326995" /codon_start=1 /product="claudin-2-like" /protein_id="XP_004331863.1" /db_xref="GI:470660662" /db_xref="GeneID:101326995" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTMLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQESRAKDRVAVVGGVFFILGGLLGFIPVVWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCSPRGNRSNYYDAYQAQPLATRSSPRPGQPPKGKSEFNSYSLTGYV" misc_feature 244..720 /gene="LOC101326995" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" STS 358..586 /gene="...
XM_004331815.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Sus scrofa claudin 22 (CLDN22), mRNA. (681 bp)
map="15" gene 1..681 /gene="CLDN22" /note="claudin 22" /db_xref="GeneID:100294683" CDS 12..668 /gene="CLDN22" /codon_start=1 /product="claudin-22" /protein_id="NP_001153557.1" /db_xref="GI:229892816" /db_xref="GeneID:100294683" /translation="MALVFRAVAQLAGILLSLLGWVLSCLTNYLPQWKNLNLDLNEMENWTMGLWQTCVIQEEVGWQCKDFDSFLALPAELRISRVLMFLSNGLGFLGLLVSGLGLDCLRIGETQQDVKKRLLILGGVLSWTAGIAALVPVSWVAHVTVQEFWDETLSEVVPRWEFGDALFIGWFAGFFLLLGGCLLSWAACGTRAPLASGHYAVVETGHHRVHPEMKTTHL" misc_feature 39..527 /gene="CLDN22" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation...
NM_001160085.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 8 (CLDN8), mRNA. (777 bp)
a" /replace="g" /db_xref="dbSNP:696615176" CDS 59..736 /gene="CLDN8" /codon_start=1 /product="claudin-8" /protein_id="NP_001155118.1" /db_xref="GI:239504576" /db_xref="GeneID:100302021" /translation="MASNALQIAGLVLGGVGMVGTVAVTVMPQWRVSAFIGSNIVVFENLWEGLWMNCMRHANIRMQCKIYDSLLALSPDLQASRGLMCTASVLSFLAFMTAILGMKCTRCTSDDEKVKSYILLTAGVLFVLTGFVVLIPVSWVANSIIRDFYNPIVDIAQKRELGEALYIGWTAALVLIAAGALFCCIFCCSERSHSYRYSIPSHRTTQRSYHMEKKSPSVYSRSQYV" misc_feature 71..604 /gene="CLDN8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement(70) /gene="CLDN8" /...
NM_001161646.1 - Sus scrofa (pig) - NCBI
PREDICTED: Tursiops truncatus claudin 16 (CLDN16), mRNA. (924 bp)
/product="LOW QUALITY PROTEIN: claudin-16" /protein_id="XP_004327380.1" /db_xref="GI:470647321" /db_xref="GeneID:101318557" /translation="MTSRTPLWVAACLYYSYRSLRRLQWGVRKRKRPAFSTSPGTRSTEDXQHSSYLRGSRAGSCPCVPADRLFVKMRDLFQYVACFFAFFSTGFLVVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADILAGFGFIILLLGLDCVKFLPDEPYIKVRICFVAGTTLLIAGAPGIIGSVWYAVDVYVERSSLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGPERNYPYSRRKGYSTTAVSMAQSYAAPRTQTAKMYAVDTRV" misc_feature 247..765 /gene="CLDN16" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
XM_004327332.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
PREDICTED: Tursiops truncatus claudin 12 (CLDN12), mRNA. (3402 bp)
LOCUS XM_004318137 3402 bp mRNA linear MAM 25-MAR-2013 DEFINITION PREDICTED: Tursiops truncatus claudin 12 (CLDN12), mRNA. ACCESSION XM_004318137 VERSION XM_004318137.1 GI:470619552 DBLINK BioProject: PRJNA189944 KEYWORDS RefSeq. SOURCE Tursiops truncatus (bottlenosed dolphin) ORGANISM Tursiops truncatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Odontoceti; Delphinidae; Tursiops. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_004318137.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Sus scrofa claudin 14 (CLDN14), mRNA. (955 bp)
t" /db_xref="dbSNP:346167810" CDS 140..859 /gene="CLDN14" /codon_start=1 /product="claudin-14" /protein_id="NP_001155114.1" /db_xref="GI:239504568" /db_xref="GeneID:100302017" /translation="MASTAVQLLGFLLSFLGLVGTLLTTLLPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGVACACAVVGMKCTRCAKGTPAKATFAVLGGVLFLLAGLLCLVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPSRPYQAQPRAGTAAAPTAPAYRPPDAYKDNRAPSAISASYSGYRLNDYV" misc_feature <269..682 /gene="CLDN14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement(169) /gene="...
NM_001161642.1 - Sus scrofa (pig) - NCBI
PREDICTED: Tursiops truncatus claudin 23 (CLDN23), mRNA. (882 bp)
LOCUS XM_004312220 882 bp mRNA linear MAM 25-MAR-2013 DEFINITION PREDICTED: Tursiops truncatus claudin 23 (CLDN23), mRNA. ACCESSION XM_004312220 VERSION XM_004312220.1 GI:470600504 DBLINK BioProject: PRJNA189944 KEYWORDS RefSeq. SOURCE Tursiops truncatus (bottlenosed dolphin) ORGANISM Tursiops truncatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Odontoceti; Delphinidae; Tursiops. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_004312220.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Sus scrofa claudin 4 (CLDN4), mRNA. (1039 bp)
gene="CLDN4" /note="upstream in-frame stop codon" CDS 163..792 /gene="CLDN4" /codon_start=1 /product="claudin-4" /protein_id="NP_001155109.1" /db_xref="GI:239504564" /db_xref="GeneID:733578" /translation="MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVICIILAVLGVLLSVVGGKCTNCVDDESAKAKTMIVAGVVFLLAGLLVMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLMLGGALLCCNCPPRTDKPYSAKYSAARSAPASNYV" misc_feature 172..672 /gene="CLDN4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement(254) /gene="CLDN4" /replace="a" /...
NM_001161637.1 - Sus scrofa (pig) - NCBI
PREDICTED: Tursiops truncatus claudin 25 (CLDN25), mRNA. (693 bp)
LOCUS XM_004332090 693 bp mRNA linear MAM 25-MAR-2013 DEFINITION PREDICTED: Tursiops truncatus claudin 25 (CLDN25), mRNA. ACCESSION XM_004332090 VERSION XM_004332090.1 GI:470624499 DBLINK BioProject: PRJNA189944 KEYWORDS RefSeq. SOURCE Tursiops truncatus (bottlenosed dolphin) ORGANISM Tursiops truncatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Odontoceti; Delphinidae; Tursiops. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_004332090.1 - Tursiops truncatus (bottlenosed dolphin) - NCBI
Sus scrofa claudin 17 (CLDN17), mRNA. (865 bp)
a" /replace="g" /db_xref="dbSNP:338930795" CDS 119..796 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="NP_001153555.1" /db_xref="GI:229892812" /db_xref="GeneID:100294681" /translation="MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFIGSNIIVFERIWEGLWMNCVRQAKARLQCKFYSSMLALSPALEAARALMCVAVALSLIALIIGICGMKKIQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVCWTANIIIRDFYNPAVHVGQKRELGAALFLGWASVAVLFIAGGLLCGFCCCNRKKQRDGYPAPRPSMPRTDERRRNMTRQSETPTSYV" misc_feature 134..664 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement(136) /gene="...
NM_001160083.1 - Sus scrofa (pig) - NCBI
Xenopus laevis claudin 18 L homeolog (cldn18.L), mRNA. (2388 bp)
L" /gene_synonym="claudin-18; cldn18" /codon_start=1 /product="claudin 18 L homeolog" /protein_id="NP_001083443.1" /db_xref="GI:148228275" /db_xref="GeneID:398928" /db_xref="Xenbase:XB-GENE-991174" /translation="MSVTMCQTMGFLVSALGFAGIIAATALDPWSTQDLYDNPVTAVFQYQGLWKSCVQQSSGFTECRPYYTILGLPAMFQAVRALMIVGIVLGAIGLLVAIFSLKCIRIGNMEDSAKANITLTSGIMFILAGLCSIIGVSVFANMLITNFWMTTANMYTGGAISGMGGMGGLQTLQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLMPEESNYKAVSYHVSTKTPGYKTSAYEDKSKKSIYNESRRSEDGKSYPSKYDYV" misc_feature 102..677 /gene="cldn18.L" /gene_synonym="claudin-18; cldn18" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: claudin-18; cldn18
NM_001089974.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 1 S homeolog (cldn1.S), mRNA. (1465 bp)
cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /codon_start=1 /product="claudin 1 S homeolog" /protein_id="NP_001079445.1" /db_xref="GI:148222888" /db_xref="GeneID:379132" /db_xref="Xenbase:XB-GENE-951614" /translation="MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKSFDSLLKLDSTIQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGDKIAKDFYNMFTPTNSKYEFGPALFIGWAGAALAIIGGALLCCSCPRKETSYPPPRGYNKSAPPAGKDYV" misc_feature 163..696 /gene="cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: claudin-1; cld1; cldn1; ilvasc; semp1
NM_001085976.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 3 L homeolog (cldn3.L), mRNA. (2908 bp)
CDS 376..1017 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /codon_start=1 /product="claudin 3 L homeolog" /protein_id="NP_001087400.1" /db_xref="GI:148227415" /db_xref="GeneID:447224" /db_xref="Xenbase:XB-GENE-6078310" /translation="MSMGLEILGVALSIVGWIGSVVCCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILAGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYLGWAASALLMLGGAMLCCSCPPKDKYPPSRVAYTAARSTNPGYDKKDYV" misc_feature 382..915 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: claudin-3; cldn3
NM_001093931.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 8, gene 2 (cldn8.2), mRNA. (2062 bp)
CDS 31..711 /gene="cldn8.2" /gene_synonym="claudin-8" /codon_start=1 /product="claudin 8, gene 2" /protein_id="NP_001120297.1" /db_xref="GI:187607335" /db_xref="GeneID:100145356" /db_xref="Xenbase:XB-GENE-991592" /translation="MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV" misc_feature 31..567 /gene="cldn8.2" /gene_synonym="claudin-8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="...
Synonym: claudin-8
NM_001126825.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 14 L homeolog (cldn14.L), mRNA. (1338 bp)
L" /gene_synonym="claudin-14; cldn14; DFNB29" /codon_start=1 /product="claudin 14 L homeolog" /protein_id="NP_001086045.1" /db_xref="GI:148231073" /db_xref="GeneID:444474" /db_xref="Xenbase:XB-GENE-995701" /translation="MASMALQLLGFSVALIGFIGTVVATVLPHWWRTAHVGTNIITAVAYMKGLWMECVWHSTGIYQCQVHQSQLALPRDLQVARAMMVASCVLSVLASVVSVFGMKCTQCAKGSSSKRVIAAFGGVFSALAGLMCLIPVAWSTNDVVQDFYNPGLPYGMKYEIGQALYIGFISGGLSVIGGIMILSTSCQKDSTPLPYTPQRRYPRKTPTSRSQPVNKSNHVPSWSSASHHGYHLNDFV" misc_feature 70..600 /gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin...
Synonym: claudin-14; cldn14; DFNB29
NM_001092576.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GI:54020932" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 19 S homeolog (cldn19.S), mRNA. (1944 bp)
gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /codon_start=1 /product="claudin 19 S homeolog" /protein_id="NP_001088886.1" /db_xref="GI:148230869" /db_xref="GeneID:496231" /db_xref="Xenbase:XB-GENE-954660" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIAVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNDERRGQQYYRQSQPSATTREITKMPAKNKEETS" misc_feature 318..854 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: claudin-19; cldn19
NM_001095417.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 1 (cldn1), mRNA. (2770 bp)
gene="cldn1" /gene_synonym="claudin-1; cld1; ilvasc; semp1" /codon_start=1 /product="claudin-1" /protein_id="NP_001015704.1" /db_xref="GI:62751357" /db_xref="GeneID:548421" /db_xref="Xenbase:XB-GENE-951609" /translation="MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKTYDSLLKLDSTMQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGNKIAKDFYNVFTPTNSKYEFGPALFIGWAGAALAILGGALLCCSCPRRETSYPPPRGYNKSAPPAGKDYV" misc_feature 164..697 /gene="cldn1" /gene_synonym="claudin-1; cld1; ilvasc; semp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="...
Synonym: claudin-1; cld1; ilvasc; semp1
NM_001015704.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Sus scrofa claudin 20 (CLDN20), mRNA. (744 bp)
gene="CLDN20" /codon_start=1 /product="claudin-20 precursor" /protein_id="NP_001153249.1" /db_xref="GI:229576871" /db_xref="GeneID:100153817" /translation="MASAGLQLLAFALALSGVSGVLTATLLPNWKVNVDAGSNIITAIVQLQGLWMDCTWYSTGMFSCSLKDSVLGLPTHVQAARAAMVLACVLSALGICTCTVGMKCTRLGGDRESKSHTCFAGGVCLVSAGISSLTPTVWYTKEIIANFLDLTVPESNKHEPGGAVYIGFISAMLLFISGLIFCTSCVKKRAEALLYPSKQQHIPISQPEDNSAYSLKDYV" sig_peptide 28..87 /gene="CLDN20" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 76..570 /gene="CLDN20" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
NM_001159777.1 - Sus scrofa (pig) - NCBI
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog (cldn5.S), mRNA. (1060 bp)
S" /gene_synonym="claudin-5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog" /protein_id="NP_001085820.1" /db_xref="GI:148235120" /db_xref="GeneID:444247" /db_xref="Xenbase:XB-GENE-17332561" /translation="MASVGMEILGLSLSTLGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALSPELQAGRALTVLASMVGLIGLLVTVVGAKCTNCLHGSSVKGRVLLAGGIIYILCGILVLIPLCWIANIIITEFYDPRVPAPQKREMGAALYVGWAATSLLMLGGSLLCGSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 180..677 /gene="cldn5.S" /gene_synonym="claudin-5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: claudin-5
NM_001092351.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 19 L homeolog (cldn19.L), mRNA. (1995 bp)
CDS 248..880 /gene="cldn19.L" /gene_synonym="claudin-19" /codon_start=1 /product="uncharacterized protein LOC494684" /protein_id="NP_001087995.1" /db_xref="GI:148223371" /db_xref="GeneID:494684" /db_xref="Xenbase:XB-GENE-17346338" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIGVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNEDRRGQQYYRQSQPSATTREYV" misc_feature 257..793 /gene="cldn19.L" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: claudin-19
NM_001094526.1 - Xenopus laevis (African clawed frog) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/claudin
lang : en | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.081 | 0.081 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.143 | 0.062 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.149 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]