GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2017-06-23 09:04:49, GGRNA : RefSeq release 81 (Mar, 2017)



Matches are highlighted with green background. Overlapping matches are dark colored.

Xenopus laevis claudin 18 L homeolog (cldn18.L), mRNA. (2388 bp)
gene="cldn18.L" /gene_synonym="claudin-18; cldn18" /codon_start=1 /product="claudin 18 L homeolog" /protein_id="NP_001083443.1" /db_xref="GeneID:398928" /db_xref="Xenbase:XB-GENE-991174" /translation="MSVTMCQTMGFLVSALGFAGIIAATALDPWSTQDLYDNPVTAVFQYQGLWKSCVQQSSGFTECRPYYTILGLPAMFQAVRALMIVGIVLGAIGLLVAIFSLKCIRIGNMEDSAKANITLTSGIMFILAGLCSIIGVSVFANMLITNFWMTTANMYTGGAISGMGGMGGLQTLQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLMPEESNYKAVSYHVSTKTPGYKTSAYEDKSKKSIYNESRRSEDGKSYPSKYDYV" misc_feature 102..677 /gene="cldn18.L" /gene_synonym="claudin-18; cldn18" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-18; cldn18
NM_001089974.1 - Xenopus laevis (African clawed frog) - NCBI
Gallus gallus claudin 3 (CLDN3), mRNA. (1736 bp)
gene="CLDN3" /gene_synonym="claudin-3" /note="upstream in-frame stop codon" CDS 632..1276 /gene="CLDN3" /gene_synonym="claudin-3" /codon_start=1 /product="claudin-3" /protein_id="NP_989533.1" /db_xref="CGNC:49012" /db_xref="GeneID:374029" /translation="MSMGLEIGGVALSVLGWLCSIICCALPMWRVTAFIGNNIVTAQIIWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALLVVAIVLAVLGLMVAIVGAQCTRCVEDETTKAKITIVSGVIFLLSGIMTLIPVSWSANTIIRDFYNPLVIDAQKRELGTSLYVGWAASALLLFGGALLCCSCPPKDERYAPSKVAYSAPRSAVTSYDKRNYV" misc_feature 638..1138 /gene="CLDN3" /gene_synonym="claudin-3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-3
NM_204202.1 - Gallus gallus (chicken) - NCBI - UCSC
Danio rerio claudin 7b (cldn7b), mRNA. (1950 bp)
gene_synonym="cb388; claudin7; cldn7; wu:fd19f08" /note="claudin-like protein ZF4A22; claudin-7; fd19f08" /codon_start=1 /product="claudin-7-B" /protein_id="NP_571712.1" /db_xref="GeneID:60635" /db_xref="ZFIN:ZDB-GENE-001103-5" /translation="MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTGQQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAMTGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGGMLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV" misc_feature 165..701 /gene="cldn7b" /gene_synonym="cb388; claudin7; cldn7; wu:fd19f08" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: cb388; claudin7; cldn7; wu:fd19f08
NM_131637.1 - Danio rerio (zebrafish) - NCBI - UCSC
Sus scrofa claudin 2 (CLDN2), mRNA. (954 bp)
gene="CLDN2" /note="claudin 2" /db_xref="GeneID:733684" misc_feature 52..54 /gene="CLDN2" /note="upstream in-frame stop codon" CDS 136..828 /gene="CLDN2" /codon_start=1 /product="claudin-2" /protein_id="NP_001155110.1" /db_xref="GeneID:733684" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTMLGLPADIQAAQAMMVTSSAISSLACIITVVGMRCTVFCQNSRAKDRVAVVGGVFFLLGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCPLQGNRSNYYDAYQAQPLATRSSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 202..678 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
NM_001161638.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 1-like (LOC396566), mRNA. (1012 bp)
replace="a" /replace="t" /db_xref="dbSNP:81402566" CDS 175..810 /gene="LOC396566" /codon_start=1 /product="claudin-1-like" /protein_id="NP_001155107.1" /db_xref="GeneID:396566" /translation="MANAGLQLLGFILAFLGWIGSIVSTALLQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATARYGNRIVQEFYHLMTPVNARYEFGQALFTGWAAASLCLLGGALLCRSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 187..693 /gene="LOC396566" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE 1 (bases 1 to 1012) AUTHORS Martin-Martin,N...
NM_001161635.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 6 (CLDN6), mRNA. (746 bp)
chromosome="3" /map="3" gene 1..746 /gene="CLDN6" /note="claudin 6" /db_xref="GeneID:100302020" CDS 19..684 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="NP_001155117.1" /db_xref="GeneID:100302020" /translation="MASAGLQILGIVLTLFGWVNALVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLSGAKCTTCVEDKDTKARLVLTSGIIFVLSGVLTLIPVCWTAHAIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGRSQGSSHYMARYSASAPHTASRGPSEYPTKNYV" misc_feature 31..528 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement...
NM_001161645.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 15 (CLDN15), mRNA. (995 bp)
db_xref="taxon:9823" gene 1..995 /gene="CLDN15" /note="claudin 15" /db_xref="GeneID:100302018" CDS 206..910 /gene="CLDN15" /codon_start=1 /product="claudin-15" /protein_id="NP_001155115.1" /db_xref="GeneID:100302018" /translation="MSVAVEIFGFFMAALGLVLLGVTLPHSSWRVSTVHGNVITTNTIFENLWYSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLFLGMVGLRCTNIGGLELSRKTKLAATAGALHILAGVCGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWTASLLSILGGICLCSSCCCAQDDDPAANVRVPYKAPMPASSLTARLPAVASDEDGDSSFGKYGKNAYV" misc_feature 290..736 /gene="CLDN15" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
NM_001161643.1 - Sus scrofa (pig) - NCBI
Salmo salar Claudin-like protein ZF-A89 (cldy), mRNA. (1517 bp)
LOCUS NM_001141277 1517 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-like protein ZF-A89 (cldy), mRNA. ACCESSION NM_001141277 VERSION NM_001141277.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT048904.1. ##Evidence-Data-START## Transcript...
NM_001141277.1 - Salmo salar (Atlantic salmon) - NCBI
Oryctolagus cuniculus claudin 12 (CLDN12), mRNA. (735 bp)
LOCUS NM_001171276 735 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus claudin 12 (CLDN12), mRNA. ACCESSION NM_001171276 VERSION NM_001171276.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae; Oryctolagus. COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from DP000945.1. FEATURES Location/...
NM_001171276.1 - Oryctolagus cuniculus (rabbit) - NCBI
Oncorhynchus mykiss claudin 30 (LOC100642186), mRNA. (627 bp)
mRNA" /db_xref="taxon:8022" gene 1..627 /gene="LOC100642186" /note="claudin 30" /db_xref="GeneID:100642186" CDS 1..627 /gene="LOC100642186" /codon_start=1 /product="claudin 30" /protein_id="NP_001233202.1" /db_xref="GeneID:100642186" /translation="MASAGFQMLGTALGIIGWIGAIVVCALPQWKVTAFIGENIITAQTTWQGIWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALIIISIMMGLVGILLSVAGGKCTNCVEDERAKSRIGVGSGVVFIIAGILCLIPVCWSANTIIRDFYNPMLMSSQKMELGAALYIGWGAAALMIMGGGFLCANCPPKEDNYPTKYSAARSTAPKDYV" misc_feature 13..543 /gene="LOC100642186" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN...
NM_001246273.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Salmo salar Claudin-14 (cld14), mRNA. (1872 bp)
LOCUS NM_001140323 1872 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-14 (cld14), mRNA. ACCESSION NM_001140323 VERSION NM_001140323.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT045650.1. ##Evidence-Data-START## Transcript exon combination...
NM_001140323.1 - Salmo salar (Atlantic salmon) - NCBI
Papio anubis claudin 12 (CLDN12), mRNA. (735 bp)
LOCUS NM_001168990 735 bp mRNA linear PRI 11-SEP-2012 DEFINITION Papio anubis claudin 12 (CLDN12), mRNA. ACCESSION NM_001168990 VERSION NM_001168990.1 KEYWORDS RefSeq. SOURCE Papio anubis (olive baboon) ORGANISM Papio anubis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Papio. COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from DP000509.1. FEATURES...
NM_001168990.1 - Papio anubis (olive baboon) - NCBI
Xenopus tropicalis claudin 4 (cldn4), mRNA. (2341 bp)
cpe-r; cper; cpetr; cpetr1; hcpe-r; wbscr8" /codon_start=1 /product="claudin-4" /protein_id="NP_001016663.1" /db_xref="GeneID:549417" /db_xref="Xenbase:XB-GENE-972439" /translation="MASMGLQVLGIALSVIGWLGTVICCALPMWRVTAFIGNNIVVAQIIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVVIAVIVAVLALLMAIIGGKCTNCVEDESSKAKVMIVAGVVFIVAGVLTLIPVSWSANNIIRDFYNPLVVDAQKRELGASLYIGWAAAALLMLGGAMLCCNCPPRDQKPYSAKYTAARSGATSNYV" misc_feature 50..583 /gene="cldn4" /gene_synonym="cpe-r; cper; cpetr; cpetr1; hcpe-r; wbscr8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" regulatory...
Synonym: cpe-r; cper; cpetr; cpetr1; hcpe-r; wbscr8
NM_001016663.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin4L2 (cldn4L2), mRNA. (925 bp)
gene="cldn4L2" /gene_synonym="cldna" /note="claudin4L2" /db_xref="GeneID:398408" CDS 60..701 /gene="cldn4L2" /gene_synonym="cldna" /codon_start=1 /product="claudin4L2" /protein_id="NP_001082330.1" /db_xref="GeneID:398408" /translation="MASTGLQILGMALALIGWVGCIITCALPMWRVTAFIGNNIVVAQTIWEGLWMNCIVQSTGQMQCKVYDSMLALSQDLQAARALTVICILVALLAMLIGVVGAKCTNCIEDKNAKAKVSMVSGIVFLVAGILLLIPVCWSANSIIRDFYNPLVVEAQKRELGAALYIGWASAALMLLGGGLLCCSCPKREDNHYSAQYTAASQPRSDYPSKNYV" misc_feature 69..575 /gene="cldn4L2" /gene_synonym="cldna" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: cldna
NM_001088861.1 - Xenopus laevis (African clawed frog) - NCBI
Gallus gallus claudin 5 (CLDN5), mRNA. (1778 bp)
map="15" gene 1..1778 /gene="CLDN5" /note="claudin 5" /db_xref="CGNC:49011" /db_xref="GeneID:374028" CDS 97..747 /gene="CLDN5" /codon_start=1 /product="claudin-5" /protein_id="NP_989532.1" /db_xref="CGNC:49011" /db_xref="GeneID:374028" /translation="MASAAVEILGLGLGILGWVGVILACGLPMWQVSAFIDVNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSILALRPEVQAGRALTVIVALLGLVALMVTVVGAQCTNCIRPGKMKSRIVIAGGTIYILCGVLVLVPLCWFANIVISDFYDPSVPPSQKREIGAALYIGWAATALLLFGGCLICCCSCLQRDETSFPVKYSAPRRPTSSGEYDKKNYV" misc_feature 184..636 /gene="CLDN5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
NM_204201.1 - Gallus gallus (chicken) - NCBI - UCSC
Sus scrofa claudin 9 (CLDN9), mRNA. (1178 bp)
gene="CLDN9" /note="upstream in-frame stop codon" CDS 209..862 /gene="CLDN9" /codon_start=1 /product="claudin-9" /protein_id="NP_001155119.1" /db_xref="GeneID:100302022" /translation="MASAGLELLGMSLAVLGWLGTLVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCAVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVVLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAASALLMLGGGLLCCTCPPPQIDRPRGPRLGYSIPSRSGASGLDKRDYV" misc_feature 221..724 /gene="CLDN9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation 243 /gene="CLDN9" /replace="c" /replace="g" /db_xref="...
NM_001161647.1 - Sus scrofa (pig) - NCBI
Salmo salar Claudin-5 (cld5), mRNA. (1344 bp)
LOCUS NM_001146383 1344 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-5 (cld5), mRNA. ACCESSION NM_001146383 VERSION NM_001146383.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT056482.1. ##Evidence-Data-START## Transcript exon combination ::...
NM_001146383.1 - Salmo salar (Atlantic salmon) - NCBI
Danio rerio claudin c (cldnc), mRNA. (1863 bp)
note="claudin c" /db_xref="GeneID:81582" /db_xref="ZFIN:ZDB-GENE-010328-3" misc_feature 148..150 /gene="cldnc" /note="upstream in-frame stop codon" CDS 316..972 /gene="cldnc" /codon_start=1 /product="claudin-9" /protein_id="NP_571839.1" /db_xref="GeneID:81582" /db_xref="ZFIN:ZDB-GENE-010328-3" /translation="MASFGLELVGVTLSVLGWILNIVCCALPMWRVTAFIGTNIVTAQVYWEGIWMSCVVQSTGQMQCKVYDSMLALPADLQAARALVVVAIIVGVLALFVAIVGAKCTNCIEEEAAKARVMISSGAAFITASVLQLIPVCWSAHTVILEFYSPLVPEAQKMEIGASLYLGWAASAMLLVGGSILCCSCPPKDETRYPPQSRIAYSAHHSVAPSTYNKRDYV" misc_feature 328..858 /gene="cldnc" /note="PMP-22/EMP/MP20/Claudin...
NM_131764.1 - Danio rerio (zebrafish) - NCBI - UCSC
PREDICTED: Microcebus murinus claudin-34-like (LOC105885998), transcript variant X2, mRNA. (2018 bp)
XM_012791370.1 - Microcebus murinus (gray mouse lemur) - NCBI
Sus scrofa claudin 22 (CLDN22), mRNA. (681 bp)
chromosome="15" /map="15" gene 1..681 /gene="CLDN22" /note="claudin 22" /db_xref="GeneID:100294683" CDS 12..668 /gene="CLDN22" /codon_start=1 /product="claudin-22" /protein_id="NP_001153557.1" /db_xref="GeneID:100294683" /translation="MALVFRAVAQLAGILLSLLGWVLSCLTNYLPQWKNLNLDLNEMENWTMGLWQTCVIQEEVGWQCKDFDSFLALPAELRISRVLMFLSNGLGFLGLLVSGLGLDCLRIGETQQDVKKRLLILGGVLSWTAGIAALVPVSWVAHVTVQEFWDETLSEVVPRWEFGDALFIGWFAGFFLLLGGCLLSWAACGTRAPLASGHYAVVETGHHRVHPEMKTTHL" misc_feature 39..527 /gene="CLDN22" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation...
NM_001160085.1 - Sus scrofa (pig) - NCBI
PREDICTED: Microcebus murinus claudin 2 (CLDN2), transcript variant X1, mRNA. (4036 bp)
all annotated introns" /db_xref="GeneID:105863674" CDS 1373..2065 /gene="CLDN2" /codon_start=1 /product="claudin-2" /protein_id="XP_012606545.1" /db_xref="GeneID:105863674" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPSQRNRSNYYDAYQAQPLATRSSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 1439..1915 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
XM_012751091.2 - Microcebus murinus (gray mouse lemur) - NCBI
PREDICTED: Microcebus murinus claudin 2 (CLDN2), transcript variant X2, mRNA. (1720 bp)
for all annotated introns" /db_xref="GeneID:105863674" CDS 357..1049 /gene="CLDN2" /codon_start=1 /product="claudin-2" /protein_id="XP_012606553.1" /db_xref="GeneID:105863674" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPSQRNRSNYYDAYQAQPLATRSSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 423..899 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" STS 537..765 /gene="CLDN2" /standard_name="...
XM_012751099.1 - Microcebus murinus (gray mouse lemur) - NCBI
Sus scrofa claudin 8 (CLDN8), mRNA. (777 bp)
CLDN8" /replace="a" /replace="g" /db_xref="dbSNP:696615176" CDS 59..736 /gene="CLDN8" /codon_start=1 /product="claudin-8" /protein_id="NP_001155118.1" /db_xref="GeneID:100302021" /translation="MASNALQIAGLVLGGVGMVGTVAVTVMPQWRVSAFIGSNIVVFENLWEGLWMNCMRHANIRMQCKIYDSLLALSPDLQASRGLMCTASVLSFLAFMTAILGMKCTRCTSDDEKVKSYILLTAGVLFVLTGFVVLIPVSWVANSIIRDFYNPIVDIAQKRELGEALYIGWTAALVLIAAGALFCCIFCCSERSHSYRYSIPSHRTTQRSYHMEKKSPSVYSRSQYV" misc_feature 71..604 /gene="CLDN8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement(70) /gene="CLDN8" /replace="c...
NM_001161646.1 - Sus scrofa (pig) - NCBI
PREDICTED: Microcebus murinus claudin-34-like (LOC105885998), transcript variant X1, mRNA. (1953 bp)
XM_012791361.2 - Microcebus murinus (gray mouse lemur) - NCBI
Danio rerio claudin 1 (cldn1), mRNA. (809 bp)
note="claudin 19" /codon_start=1 /product="claudin-1 precursor" /protein_id="NP_571845.1" /db_xref="GeneID:81590" /db_xref="ZFIN:ZDB-GENE-010328-11" /translation="MAHAGLQMLGYCLGFLGLLGLIASTAMAEWKMSSYAGDNIITAQAQYEGLWQSCVSQSTGQLQCKKYDSLLKLPGEIQGARGLMLTGIFLCGLSTLVSFVGMKCTTCLSEAPQVKSKVALAGGVLFITGGLFALIATSWYGEKIRQKFFDPFTPTNARYEFGKALYVGWGSSALSIIGGSLLCCICGSEASEKPSYPPARAAGRPGTDRV" sig_peptide 2..85 /gene="cldn1" /gene_synonym="cldn19" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 71..547 /gene="cldn1" /gene_synonym="cldn19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: cldn19
NM_131770.1 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio claudin j (cldnj), mRNA. (3542 bp)
note="claudin j" /db_xref="GeneID:81589" /db_xref="ZFIN:ZDB-GENE-010328-10" CDS 34..666 /gene="cldnj" /gene_synonym="fc30g01; wu:fc30g01" /codon_start=1 /product="claudin j" /protein_id="NP_571844.1" /db_xref="GeneID:81589" /db_xref="ZFIN:ZDB-GENE-010328-10" /translation="MALQVLGITLSMIGFAGTIIICALPMWKVTAFIGTNIVVAQVFWEGLWMTCVYERIGQMQCKLYDALLDLDPFLQASRGLIVTTMALASLAFLIFLIGADCTNCLSNPRAKGRIVVVSGITFMLSGLTTVVPVSWTADSIIRDFHNPVVHEALKREMGAALYVGWLTAGFLFVGGAILCTSCPPERDNYLPRYTLTKSGTHSGYAVKNYV" misc_feature 34..567 /gene="cldnj" /gene_synonym="fc30g01; wu:fc30g01" /note="PMP-22/EMP/MP20/Claudin family;...
Synonym: fc30g01; wu:fc30g01
NM_131769.1 - Danio rerio (zebrafish) - NCBI - UCSC
Sus scrofa claudin 14 (CLDN14), mRNA. (955 bp)
c" /replace="t" /db_xref="dbSNP:346167810" CDS 140..859 /gene="CLDN14" /codon_start=1 /product="claudin-14" /protein_id="NP_001155114.1" /db_xref="GeneID:100302017" /translation="MASTAVQLLGFLLSFLGLVGTLLTTLLPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGVACACAVVGMKCTRCAKGTPAKATFAVLGGVLFLLAGLLCLVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPSRPYQAQPRAGTAAAPTAPAYRPPDAYKDNRAPSAISASYSGYRLNDYV" misc_feature <269..682 /gene="CLDN14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement(169) /gene="CLDN14" /replace...
NM_001161642.1 - Sus scrofa (pig) - NCBI
Danio rerio claudin h (cldnh), mRNA. (1880 bp)
gene="cldnh" /gene_synonym="fc56d05; wu:fc56d05" /codon_start=1 /product="claudin-3" /protein_id="NP_571842.1" /db_xref="GeneID:81587" /db_xref="ZFIN:ZDB-GENE-010328-8" /translation="MSMGLEIGGIALGIIGWIISIVACALPMWRVSAFVGANIVTAQVIWEGLWMNCVVQSTGQMQCKVYDSMLALGQDLQASRAMTVIAIILAVLGVMISVMGAKCTNCIEDEGAKAKVMIVSGIMFIIAGILDLIPSAWVANQIIRDFYNPLLPGAQQRELGASIYIGFAAAALLIIGGAMLCCTCPPKEKKYKPARMGYSAPRSASAGYDKKDYV" misc_feature 123..602 /gene="cldnh" /gene_synonym="fc56d05; wu:fc56d05" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement(215) /gene="...
Synonym: fc56d05; wu:fc56d05
NM_131767.1 - Danio rerio (zebrafish) - NCBI - UCSC
Sus scrofa claudin 4 (CLDN4), mRNA. (1039 bp)
feature 157..159 /gene="CLDN4" /note="upstream in-frame stop codon" CDS 163..792 /gene="CLDN4" /codon_start=1 /product="claudin-4" /protein_id="NP_001155109.1" /db_xref="GeneID:733578" /translation="MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVICIILAVLGVLLSVVGGKCTNCVDDESAKAKTMIVAGVVFLLAGLLVMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLMLGGALLCCNCPPRTDKPYSAKYSAARSAPASNYV" misc_feature 172..672 /gene="CLDN4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement(254) /gene="CLDN4" /replace="a" /replace...
NM_001161637.1 - Sus scrofa (pig) - NCBI
PREDICTED: Microcebus murinus claudin 34 (CLDN34), mRNA. (1081 bp)
LOCUS XM_020284849 1081 bp mRNA linear PRI 24-FEB-2017 DEFINITION PREDICTED: Microcebus murinus claudin 34 (CLDN34), mRNA. ACCESSION XM_020284849 VERSION XM_020284849.1 DBLINK BioProject: PRJNA285159 KEYWORDS RefSeq. SOURCE Microcebus murinus (gray mouse lemur) ORGANISM Microcebus murinus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Strepsirrhini; Lemuriformes; Cheirogaleidae; Microcebus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_020284849.1 - Microcebus murinus (gray mouse lemur) - NCBI
Sus scrofa claudin 17 (CLDN17), mRNA. (865 bp)
replace="a" /replace="g" /db_xref="dbSNP:338930795" CDS 119..796 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="NP_001153555.1" /db_xref="GeneID:100294681" /translation="MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFIGSNIIVFERIWEGLWMNCVRQAKARLQCKFYSSMLALSPALEAARALMCVAVALSLIALIIGICGMKKIQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVCWTANIIIRDFYNPAVHVGQKRELGAALFLGWASVAVLFIAGGLLCGFCCCNRKKQRDGYPAPRPSMPRTDERRRNMTRQSETPTSYV" misc_feature 134..664 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation complement(136) /gene="CLDN17" /replace="a" /...
NM_001160083.1 - Sus scrofa (pig) - NCBI
Danio rerio claudin e (cldne), mRNA. (1955 bp)
note="claudin e" /db_xref="GeneID:81584" /db_xref="ZFIN:ZDB-GENE-010328-5" CDS 49..678 /gene="cldne" /gene_synonym="cb84; fb16e12; wu:fb16e12" /codon_start=1 /product="claudin-4" /protein_id="NP_571840.1" /db_xref="GeneID:81584" /db_xref="ZFIN:ZDB-GENE-010328-5" /translation="MVSMCREILGMCLAIIGFLGAIIICALPMWKVTAFIGANIVTAQTIWEGLWMNCVMQSTGQMQCKIYDSLLALPQDLQAARALVVIAIIVSFFALILGIAGGKCTNFVEREDAKAKVSIASGVIFIIAGVLVLVPVCWSANTIIRDFYNPLLTDAQRREMGASLYIGWGVAALLIIGGGILCSSCPPKDEKYNMKYSQPRSTATSRAYV" misc_feature 58..591 /gene="cldne" /gene_synonym="cb84; fb16e12; wu:fb16e12" /note="PMP-22/EMP/MP20/Claudin...
Synonym: cb84; fb16e12; wu:fb16e12
NM_131765.1 - Danio rerio (zebrafish) - NCBI - UCSC
Sus scrofa claudin 20 (CLDN20), mRNA. (744 bp)
CDS 28..687 /gene="CLDN20" /codon_start=1 /product="claudin-20 precursor" /protein_id="NP_001153249.1" /db_xref="GeneID:100153817" /translation="MASAGLQLLAFALALSGVSGVLTATLLPNWKVNVDAGSNIITAIVQLQGLWMDCTWYSTGMFSCSLKDSVLGLPTHVQAARAAMVLACVLSALGICTCTVGMKCTRLGGDRESKSHTCFAGGVCLVSAGISSLTPTVWYTKEIIANFLDLTVPESNKHEPGGAVYIGFISAMLLFISGLIFCTSCVKKRAEALLYPSKQQHIPISQPEDNSAYSLKDYV" sig_peptide 28..87 /gene="CLDN20" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 76..570 /gene="CLDN20" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" variation...
NM_001159777.1 - Sus scrofa (pig) - NCBI
Danio rerio claudin d (cldnd), mRNA. (755 bp)
gene_synonym="ns:zf-a310; zf-a310; zgc:101004" /codon_start=1 /product="claudin-like protein ZF-A89" /protein_id="NP_851295.1" /db_xref="GeneID:81583" /db_xref="ZFIN:ZDB-GENE-010328-4" /translation="MASVGLQLLATVLAIIGWLGEIVICALPMWKVTAFIGNNIVTAQIFWEGLWMNCVQQSTGQMQCKVYDSMLALPQDLQAARALVVISIIVTFMGVFLTIAGGKCTNCIEDQDAKAKVVVAAGVFFLVGGILCLIPVCWSANSVIKDFYNPTLSDAQKRELGASLFIGWCASGLLLLGGALLCCQCPKNEGRAYSVKYSAPRSAPGAYV" misc_feature 23..520 /gene="cldnd" /gene_synonym="ns:zf-a310; zf-a310; zgc:101004" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" misc_feature...
Synonym: ns:zf-a310; zf-a310; zgc:101004
NM_180964.2 - Danio rerio (zebrafish) - NCBI - UCSC
Sus scrofa claudin 23 (CLDN23), mRNA. (1052 bp)
LOCUS NM_001159778 1052 bp mRNA linear MAM 18-APR-2013 DEFINITION Sus scrofa claudin 23 (CLDN23), mRNA. ACCESSION NM_001159778 XM_001928555 VERSION NM_001159778.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from FJ875107.1. On May 8, 2009 this sequence version replaced XM_001928555.1. ##Evidence-Data-START## Transcript...
NM_001159778.1 - Sus scrofa (pig) - NCBI
Xenopus laevis claudin 1 S homeolog (cldn1.S), mRNA. (1465 bp)
gene="cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /codon_start=1 /product="claudin 1 S homeolog" /protein_id="NP_001079445.1" /db_xref="GeneID:379132" /db_xref="Xenbase:XB-GENE-951614" /translation="MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKSFDSLLKLDSTIQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGDKIAKDFYNMFTPTNSKYEFGPALFIGWAGAALAIIGGALLCCSCPRKETSYPPPRGYNKSAPPAGKDYV" misc_feature 163..696 /gene="cldn1.S" /gene_synonym="claudin-1; cld1; cldn1; ilvasc; semp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: claudin-1; cld1; cldn1; ilvasc; semp1
NM_001085976.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 3 L homeolog (cldn3.L), mRNA. (2908 bp)
ynonym="claudin-3; cldn3" /note="upstream in-frame stop codon" CDS 376..1017 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /codon_start=1 /product="claudin 3 L homeolog" /protein_id="NP_001087400.1" /db_xref="GeneID:447224" /db_xref="Xenbase:XB-GENE-6078310" /translation="MSMGLEILGVALSIVGWIGSVVCCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILAGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYLGWAASALLMLGGAMLCCSCPPKDKYPPSRVAYTAARSTNPGYDKKDYV" misc_feature 382..915 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /note="PMP-22/EMP/MP20/Claudin family...
Synonym: claudin-3; cldn3
NM_001093931.1 - Xenopus laevis (African clawed frog) - NCBI
Pan troglodytes claudin 11 (CLDN11), mRNA. (2174 bp)
="claudin-11" /note="upstream in-frame stop codon" CDS 200..823 /gene="CLDN11" /gene_synonym="claudin-11" /note="claudin 11 (oligodendrocyte transmembrane protein)" /codon_start=1 /product="claudin-11" /protein_id="NP_001233342.1" /db_xref="GeneID:460846" /db_xref="VGNC:VGNC:1780" /translation="MVATFLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV" misc_feature 215..715 /gene="CLDN11" /gene_synonym="claudin-11" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-11
NM_001246413.1 - Pan troglodytes (chimpanzee) - NCBI
Xenopus tropicalis claudin 8, gene 2 (cldn8.2), mRNA. (2062 bp)
XB-GENE-991592" CDS 31..711 /gene="cldn8.2" /gene_synonym="claudin-8" /codon_start=1 /product="claudin 8, gene 2" /protein_id="NP_001120297.1" /db_xref="GeneID:100145356" /db_xref="Xenbase:XB-GENE-991592" /translation="MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV" misc_feature 31..567 /gene="cldn8.2" /gene_synonym="claudin-8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: claudin-8
NM_001126825.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 14 L homeolog (cldn14.L), mRNA. (1338 bp)
gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /codon_start=1 /product="claudin 14 L homeolog" /protein_id="NP_001086045.1" /db_xref="GeneID:444474" /db_xref="Xenbase:XB-GENE-995701" /translation="MASMALQLLGFSVALIGFIGTVVATVLPHWWRTAHVGTNIITAVAYMKGLWMECVWHSTGIYQCQVHQSQLALPRDLQVARAMMVASCVLSVLASVVSVFGMKCTQCAKGSSSKRVIAAFGGVFSALAGLMCLIPVAWSTNDVVQDFYNPGLPYGMKYEIGQALYIGFISGGLSVIGGIMILSTSCQKDSTPLPYTPQRRYPRKTPTSRSQPVNKSNHVPSWSSASHHGYHLNDFV" misc_feature 70..600 /gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: claudin-14; cldn14; DFNB29
NM_001092576.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 19 S homeolog (cldn19.S), mRNA. (1944 bp)
"claudin-19; cldn19" /note="upstream in-frame stop codon" CDS 309..974 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /codon_start=1 /product="claudin 19 S homeolog" /protein_id="NP_001088886.1" /db_xref="GeneID:496231" /db_xref="Xenbase:XB-GENE-954660" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIAVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNDERRGQQYYRQSQPSATTREITKMPAKNKEETS" misc_feature 318..854 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-19; cldn19
NM_001095417.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 1 (cldn1), mRNA. (2770 bp)
codon" CDS 152..787 /gene="cldn1" /gene_synonym="claudin-1; cld1; ilvasc; semp1" /codon_start=1 /product="claudin-1" /protein_id="NP_001015704.1" /db_xref="GeneID:548421" /db_xref="Xenbase:XB-GENE-951609" /translation="MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKTYDSLLKLDSTMQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGNKIAKDFYNVFTPTNSKYEFGPALFIGWAGAALAILGGALLCCSCPRRETSYPPPRGYNKSAPPAGKDYV" misc_feature 164..697 /gene="cldn1" /gene_synonym="claudin-1; cld1; ilvasc; semp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: claudin-1; cld1; ilvasc; semp1
NM_001015704.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Rattus norvegicus claudin 19 (Cldn19), mRNA. (1626 bp)
gene="Cldn19" /gene_synonym="claudin-19" /note="upstream in-frame stop codon" CDS 85..720 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19" /protein_id="NP_001008514.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREYV" misc_feature 94..630 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-19
NM_001008514.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog (cldn5.S), mRNA. (1060 bp)
gene="cldn5.S" /gene_synonym="claudin-5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog" /protein_id="NP_001085820.1" /db_xref="GeneID:444247" /db_xref="Xenbase:XB-GENE-17332561" /translation="MASVGMEILGLSLSTLGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALSPELQAGRALTVLASMVGLIGLLVTVVGAKCTNCLHGSSVKGRVLLAGGIIYILCGILVLIPLCWIANIIITEFYDPRVPAPQKREMGAALYVGWAATSLLMLGGSLLCGSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 180..677 /gene="cldn5.S" /gene_synonym="claudin-5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-5
NM_001092351.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 19 L homeolog (cldn19.L), mRNA. (1995 bp)
synonym="claudin-19" /note="upstream in-frame stop codon" CDS 248..880 /gene="cldn19.L" /gene_synonym="claudin-19" /codon_start=1 /product="uncharacterized protein LOC494684" /protein_id="NP_001087995.1" /db_xref="GeneID:494684" /db_xref="Xenbase:XB-GENE-17346338" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIGVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNEDRRGQQYYRQSQPSATTREYV" misc_feature 257..793 /gene="cldn19.L" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family;...
Synonym: claudin-19
NM_001094526.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) (cldn5), mRNA. (2593 bp)
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1; claudin-5; cpetrl1; tmvcf
NM_001006706.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 6, gene 2 L homeolog (cldn6.2.L), mRNA. (933 bp)
synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="claudin4L1" /codon_start=1 /product="claudin 6, gene 2 L homeolog" /protein_id="NP_001082332.1" /db_xref="GeneID:398409" /db_xref="Xenbase:XB-GENE-1009651" /translation="MASTGLQVLGMAMSIIGWVGCIITCAMPMWRVTAFIGNNIVVAQIIWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALTVICILVALLAMLVGIVGAKCTNCIEDENTKAKVSMVSGVVFLVAGILMLIPVCWSANSIIRDFYNPLVVEAQKRELGAAIYIGWASSALMLLGGGLLCCSCPKKNDAPYSARYTAPSGPARSDYPSKNYV" misc_feature 61..567 /gene="cldn6.2.L" /gene_synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA
NM_001088863.1 - Xenopus laevis (African clawed frog) - NCBI
Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1944 bp)
DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. ACCESSION NM_001185023 VERSION NM_001185023.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (2029 bp)
ns claudin 7 (CLDN7), transcript variant 1, mRNA. ACCESSION NM_001307 VERSION NM_001307.5 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On May 29, 2010 this sequence version replaced NM_001307.4. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.080 | 0.080 | count_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.140 | 0.060 | search_done;*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.146 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]