GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-07-19 07:04:14, GGRNA : RefSeq release 88 (May, 2018)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1944 bp)
DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. ACCESSION NM_001185023 VERSION NM_001185023.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (2029 bp)
ns claudin 7 (CLDN7), transcript variant 1, mRNA. ACCESSION NM_001307 VERSION NM_001307.5 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On May 29, 2010 this sequence version replaced NM_001307.4. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 11 (Cldn11), mRNA. (1872 bp)
us claudin 11 (Cldn11), mRNA. ACCESSION NM_008770 VERSION NM_008770.3 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: Claudin-11; Claudin11; Osp; Otm
NM_008770.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
MAY-2018 DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. ACCESSION NM_001185022 VERSION NM_001185022.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AJ011497.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Pongo abelii claudin 12 (CLDN12), mRNA. (3502 bp)
Data-START## Transcript exon combination :: CR859386.1, CR557419.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..3502 /organism="Pongo abelii" /mol_type="mRNA" /db_xref="taxon:9601" /chromosome="7" /map="7" gene 1..3502 /gene="CLDN12" /gene_synonym="Claudin-12" /note="claudin 12" /db_xref="GeneID:100174503" exon 2..84 /gene="CLDN12" /gene_synonym="Claudin-12" /inference="alignment:Splign:2.1.0" exon 85..174 /gene="CLDN12" /gene_synonym="Claudin-12" /inference="alignment:Splign:2.1.0" exon 175..3491 /gene="CLDN12" /gene_synonym="Claudin-12" /inference="alignment:...
Synonym: Claudin-12
NM_001133960.1 - Pongo abelii (Sumatran orangutan) - NCBI
Ictalurus punctatus claudin 15 (cldn15), mRNA. (1474 bp)
Data-START## Transcript exon combination :: KM870792.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1474 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="7" /map="7" gene 1..1474 /gene="cldn15" /gene_synonym="Claudin-15; CLDN15a" /note="claudin 15" /db_xref="GeneID:108267636" misc_feature 222..224 /gene="cldn15" /gene_synonym="Claudin-15; CLDN15a" /note="upstream in-frame stop codon" CDS 282..953 /gene="cldn15" /gene_synonym="Claudin-15; CLDN15a" /note="claudin 15a" /codon_start=1 /product="claudin 15" /protein_id="NP...
Synonym: Claudin-15; CLDN15a
NM_001329306.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-8-like (LOC108277897), mRNA. (2895 bp)
Data-START## Transcript is intronless :: KM870785.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..2895 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="17" /map="17" gene 1..2895 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="claudin-8-like" /db_xref="GeneID:108277897" misc_feature 893..895 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="upstream in-frame stop codon" CDS 911..1951 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="claudin 8c" /codon_start=1 /product="...
Synonym: Claudin-8; CLDN8; CLDN8c
NM_001329287.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin 1 (cldn1), mRNA. (1765 bp)
single sample supports all introns SAMN00774075 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1765 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="17" /map="17" gene 1..1765 /gene="cldn1" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="claudin 1" /db_xref="GeneID:108278410" misc_feature 810..812 /gene="cldn1" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="upstream in-frame stop codon" CDS 882..1547 /gene="cldn1" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="claudin 26" /codon_start=1 /product="claudin 1 precursor" /...
Synonym: Claudin-10; CLDN10; CLDN26
NM_001329305.1 - Ictalurus punctatus (channel catfish) - NCBI
Xenopus laevis claudin 3 L homeolog (cldn3.L), mRNA. (2908 bp)
ynonym="claudin-3; cldn3" /note="upstream in-frame stop codon" CDS 376..1017 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /codon_start=1 /product="claudin 3 L homeolog" /protein_id="NP_001087400.1" /db_xref="GeneID:447224" /db_xref="Xenbase:XB-GENE-6078310" /translation="MSMGLEILGVALSIVGWIGSVVCCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILAGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYLGWAASALLMLGGAMLCCSCPPKDKYPPSRVAYTAARSTNPGYDKKDYV" misc_feature 382..915 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /note="PMP-22/EMP/MP20/Claudin family...
Synonym: claudin-3; cldn3
NM_001093931.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 8, gene 2 (cldn8.2), mRNA. (2062 bp)
XB-GENE-991592" CDS 31..711 /gene="cldn8.2" /gene_synonym="claudin-8" /codon_start=1 /product="claudin 8, gene 2" /protein_id="NP_001120297.1" /db_xref="GeneID:100145356" /db_xref="Xenbase:XB-GENE-991592" /translation="MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV" misc_feature 31..567 /gene="cldn8.2" /gene_synonym="claudin-8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: claudin-8
NM_001126825.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 14 L homeolog (cldn14.L), mRNA. (1338 bp)
gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /codon_start=1 /product="claudin 14 L homeolog" /protein_id="NP_001086045.1" /db_xref="GeneID:444474" /db_xref="Xenbase:XB-GENE-995701" /translation="MASMALQLLGFSVALIGFIGTVVATVLPHWWRTAHVGTNIITAVAYMKGLWMECVWHSTGIYQCQVHQSQLALPRDLQVARAMMVASCVLSVLASVVSVFGMKCTQCAKGSSSKRVIAAFGGVFSALAGLMCLIPVAWSTNDVVQDFYNPGLPYGMKYEIGQALYIGFISGGLSVIGGIMILSTSCQKDSTPLPYTPQRRYPRKTPTSRSQPVNKSNHVPSWSSASHHGYHLNDFV" misc_feature 70..600 /gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: claudin-14; cldn14; DFNB29
NM_001092576.1 - Xenopus laevis (African clawed frog) - NCBI
Pan troglodytes claudin 11 (CLDN11), mRNA. (2174 bp)
="claudin-11" /note="upstream in-frame stop codon" CDS 200..823 /gene="CLDN11" /gene_synonym="claudin-11" /note="claudin 11 (oligodendrocyte transmembrane protein)" /codon_start=1 /product="claudin-11" /protein_id="NP_001233342.1" /db_xref="GeneID:460846" /db_xref="VGNC:VGNC:1780" /translation="MVATFLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV" misc_feature 215..715 /gene="CLDN11" /gene_synonym="claudin-11" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-11
NM_001246413.1 - Pan troglodytes (chimpanzee) - NCBI
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 19 S homeolog (cldn19.S), mRNA. (1944 bp)
"claudin-19; cldn19" /note="upstream in-frame stop codon" CDS 309..974 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /codon_start=1 /product="claudin 19 S homeolog" /protein_id="NP_001088886.1" /db_xref="GeneID:496231" /db_xref="Xenbase:XB-GENE-954660" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIAVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNDERRGQQYYRQSQPSATTREITKMPAKNKEETS" misc_feature 318..854 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-19; cldn19
NM_001095417.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus claudin 7 (Cldn7), transcript variant 1, mRNA. (1311 bp)
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145504.1 and BG083098.2. On Aug 6, 2010 this sequence version replaced NM_016887.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
NM_016887.6 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog (cldn5.S), mRNA. (1060 bp)
gene="cldn5.S" /gene_synonym="claudin-5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog" /protein_id="NP_001085820.1" /db_xref="GeneID:444247" /db_xref="Xenbase:XB-GENE-17332561" /translation="MASVGMEILGLSLSTLGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALSPELQAGRALTVLASMVGLIGLLVTVVGAKCTNCLHGSSVKGRVLLAGGIIYILCGILVLIPLCWIANIIITEFYDPRVPAPQKREMGAALYVGWAATSLLMLGGSLLCGSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 180..677 /gene="cldn5.S" /gene_synonym="claudin-5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-5
NM_001092351.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 19 L homeolog (cldn19.L), mRNA. (1995 bp)
synonym="claudin-19" /note="upstream in-frame stop codon" CDS 248..880 /gene="cldn19.L" /gene_synonym="claudin-19" /codon_start=1 /product="uncharacterized protein LOC494684" /protein_id="NP_001087995.1" /db_xref="GeneID:494684" /db_xref="Xenbase:XB-GENE-17346338" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIGVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNEDRRGQQYYRQSQPSATTREYV" misc_feature 257..793 /gene="cldn19.L" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family;...
Synonym: claudin-19
NM_001094526.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. (989 bp)
DEFINITION Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. ACCESSION NM_001193619 VERSION NM_001193619.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL596185.12. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
NM_001193619.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) (cldn5), mRNA. (2593 bp)
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1; claudin-5; cpetrl1; tmvcf
NM_001006706.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. (1035 bp)
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160098.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v2, mRNA. (1092 bp)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160097.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. (1143 bp)
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160096.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 6, gene 2 L homeolog (cldn6.2.L), mRNA. (933 bp)
synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="claudin4L1" /codon_start=1 /product="claudin 6, gene 2 L homeolog" /protein_id="NP_001082332.1" /db_xref="GeneID:398409" /db_xref="Xenbase:XB-GENE-1009651" /translation="MASTGLQVLGMAMSIIGWVGCIITCAMPMWRVTAFIGNNIVVAQIIWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALTVICILVALLAMLVGIVGAKCTNCIEDENTKAKVSMVSGVVFLVAGILMLIPVCWSANSIIRDFYNPLVVEAQKRELGAAIYIGWASSALMLLGGGLLCCSCPKKNDAPYSARYTAPSGPARSDYPSKNYV" misc_feature 61..567 /gene="cldn6.2.L" /gene_synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA
NM_001088863.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant a, mRNA. (1200 bp)
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_023878.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 12 S homeolog (cldn12.S), mRNA. (1179 bp)
LOCUS NM_001095510 1179 bp mRNA linear VRT 29-OCT-2016 DEFINITION Xenopus laevis claudin 12 S homeolog (cldn12.S), mRNA. ACCESSION NM_001095510 VERSION NM_001095510.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC088962.1. ##Evidence-Data-START## Transcript exon combination ::...
Synonym: claudin-12; cldn12
NM_001095510.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 12 (cldn12), mRNA. (2983 bp)
LOCUS NM_001016851 2983 bp mRNA linear VRT 28-OCT-2016 DEFINITION Xenopus tropicalis claudin 12 (cldn12), mRNA. ACCESSION NM_001016851 NM_001015839 VERSION NM_001016851.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CR855430.2. On or before Oct 7, 2010 this sequence...
Synonym: claudin-12
NM_001016851.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog (cldn5.L), mRNA. (2376 bp)
cldn5.L" /gene_synonym="claudin-5; cldn5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog" /protein_id="NP_001083445.1" /db_xref="GeneID:398929" /db_xref="Xenbase:XB-GENE-6078354" /translation="MASAAMEIIGLSLSILGWIGVILTCGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALHPELQAGRALTVLASIVGLVGLLVTIVGAKCTNCLQGSSVKSRVLLAGGIIYIVCGILLLVPLCWIANIVITEFYDPRVPASQKREMGAALYIGWGATSLLLLGGSLLCCSFAMKDGISNLPVKYSAPRIPTSNGDYDKKNYV" misc_feature 103..594 /gene="cldn5.L" /gene_synonym="claudin-5; cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: claudin-5; cldn5
NM_001089976.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. (852 bp)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160099.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 1-like (LOC396566), mRNA. (1012 bp)
gene="LOC396566" /note="claudin 1-like" /db_xref="GeneID:396566" misc_feature 34..36 /gene="LOC396566" /note="upstream in-frame stop codon" CDS 175..810 /gene="LOC396566" /codon_start=1 /product="claudin-1-like" /protein_id="NP_001155107.1" /db_xref="GeneID:396566" /translation="MANAGLQLLGFILAFLGWIGSIVSTALLQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATARYGNRIVQEFYHLMTPVNARYEFGQALFTGWAAASLCLLGGALLCRSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 187..693 /gene="LOC396566" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
NM_001161635.1 - Sus scrofa (pig) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant b, mRNA. (960 bp)
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_021386.3. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_021386.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 19 (Cldn19), transcript variant X1, mRNA. (3442 bp)
xref="RGD:1305000" CDS 278..952 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19 isoform X1" /protein_id="XP_006238818.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREPVVKLSTSVKGPLGV" misc_feature 287..823 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
Synonym: claudin-19
XM_006238756.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 6 (CLDN6), mRNA. (746 bp)
chromosome="3" /map="3" gene 1..746 /gene="CLDN6" /note="claudin 6" /db_xref="GeneID:100302020" CDS 19..684 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="NP_001155117.1" /db_xref="GeneID:100302020" /translation="MASAGLQILGIVLTLFGWVNALVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLSGAKCTTCVEDKDTKARLVLTSGIIFVLSGVLTLIPVCWTAHAIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGRSQGSSHYMARYSASAPHTASRGPSEYPTKNYV" misc_feature 31..528 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
NM_001161645.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 22 (CLDN22), mRNA. (681 bp)
chromosome="15" /map="15" gene 1..681 /gene="CLDN22" /note="claudin 22" /db_xref="GeneID:100294683" CDS 12..668 /gene="CLDN22" /codon_start=1 /product="claudin-22" /protein_id="NP_001153557.1" /db_xref="GeneID:100294683" /translation="MALVFRAVAQLAGILLSLLGWVLSCLTNYLPQWKNLNLDLNEMENWTMGLWQTCVIQEEVGWQCKDFDSFLALPAELRISRVLMFLSNGLGFLGLLVSGLGLDCLRIGETQQDVKKRLLILGGVLSWTAGIAALVPVSWVAHVTVQEFWDETLSEVVPRWEFGDALFIGWFAGFFLLLGGCLLSWAACGTRAPLASGHYAVVETGHHRVHPEMKTTHL" misc_feature 39..527 /gene="CLDN22" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
NM_001160085.1 - Sus scrofa (pig) - NCBI
Gallus gallus claudin 10 (CLDN10), transcript variant 2, mRNA. (843 bp)
variant 2" /codon_start=1 /product="claudin-10 isoform 2 precursor" /protein_id="NP_001264697.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" sig_peptide 11..79 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 29..427 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-10
NM_001277768.1 - Gallus gallus (chicken) - NCBI - UCSC
Sus scrofa claudin 8 (CLDN8), mRNA. (777 bp)
chromosome="13" /map="13" gene 1..777 /gene="CLDN8" /note="claudin 8" /db_xref="GeneID:100302021" CDS 59..736 /gene="CLDN8" /codon_start=1 /product="claudin-8" /protein_id="NP_001155118.1" /db_xref="GeneID:100302021" /translation="MASNALQIAGLVLGGVGMVGTVAVTVMPQWRVSAFIGSNIVVFENLWEGLWMNCMRHANIRMQCKIYDSLLALSPDLQASRGLMCTASVLSFLAFMTAILGMKCTRCTSDDEKVKSYILLTAGVLFVLTGFVVLIPVSWVANSIIRDFYNPIVDIAQKRELGEALYIGWTAALVLIAAGALFCCIFCCSERSHSYRYSIPSHRTTQRSYHMEKKSPSVYSRSQYV" misc_feature 71..604 /gene="CLDN8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" STS 135..380 /...
NM_001161646.1 - Sus scrofa (pig) - NCBI
Mus musculus claudin 18 (Cldn18), transcript variant A2.1, mRNA. (2774 bp)
Mus musculus claudin 18 (Cldn18), transcript variant A2.1, mRNA. ACCESSION NM_001194921 VERSION NM_001194921.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK033657.1, AF349451.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001194921.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 18 (Cldn18), transcript variant A2.2, mRNA. (2786 bp)
Mus musculus claudin 18 (Cldn18), transcript variant A2.2, mRNA. ACCESSION NM_001194923 VERSION NM_001194923.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF349453.1, AA028634.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_001194923.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Gallus gallus claudin 10 (CLDN10), transcript variant 3, mRNA. (826 bp)
="claudin-10" /note="claudin 10" /db_xref="CGNC:13756" /db_xref="GeneID:418790" CDS 24..560 /gene="CLDN10" /gene_synonym="claudin-10" /note="isoform 3 is encoded by transcript variant 3" /codon_start=1 /product="claudin-10 isoform 3" /protein_id="NP_001264698.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MNCAGNALGAFHCRPHLTIFKVEGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" misc_feature <81..410 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-10
NM_001277769.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus claudin 10 (CLDN10), transcript variant 1, mRNA. (963 bp)
product="claudin-10 isoform 1 precursor" /protein_id="NP_001264696.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" sig_peptide 11..79 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 29..547 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: claudin-10
NM_001277767.1 - Gallus gallus (chicken) - NCBI - UCSC
Homo sapiens claudin 5 (CLDN5), transcript variant 3, mRNA. (1821 bp)
Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC000082.4 and BU688528.1. On May 5, 2018 this sequence version replaced XM_017028929.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in...
Synonym: AWAL; BEC1; CPETRL1; TMDVCF; TMVCF
NM_001363067.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 20 (CLDN20), mRNA. (744 bp)
CLDN20" /note="claudin 20" /db_xref="GeneID:100153817" CDS 28..687 /gene="CLDN20" /codon_start=1 /product="claudin-20 precursor" /protein_id="NP_001153249.1" /db_xref="GeneID:100153817" /translation="MASAGLQLLAFALALSGVSGVLTATLLPNWKVNVDAGSNIITAIVQLQGLWMDCTWYSTGMFSCSLKDSVLGLPTHVQAARAAMVLACVLSALGICTCTVGMKCTRLGGDRESKSHTCFAGGVCLVSAGISSLTPTVWYTKEIIANFLDLTVPESNKHEPGGAVYIGFISAMLLFISGLIFCTSCVKKRAEALLYPSKQQHIPISQPEDNSAYSLKDYV" sig_peptide 28..87 /gene="CLDN20" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 76..570 /gene="CLDN20" /note="PMP-22/EMP/MP20/Claudin family; Region:...
NM_001159777.1 - Sus scrofa (pig) - NCBI
Mus musculus claudin 3 (Cldn3), mRNA. (1263 bp)
s claudin 3 (Cldn3), mRNA. ACCESSION NM_009902 VERSION NM_009902.4 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK002672.1 and AV041302.2. On Aug 4, 2010 this sequence version replaced NM_009902.3. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: AI182374; Cpetr2; mRVP1
NM_009902.4 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 5 (CLDN5), transcript variant 4, mRNA. (1402 bp)
DEFINITION Homo sapiens claudin 5 (CLDN5), transcript variant 4, mRNA. ACCESSION NM_001363066 VERSION NM_001363066.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK124019.1, BC032363.1 and BU688528.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: AWAL; BEC1; CPETRL1; TMDVCF; TMVCF
NM_001363066.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 18 (Cldn18), transcript variant A1.2, mRNA. (2849 bp)
musculus claudin 18 (Cldn18), transcript variant A1.2, mRNA. ACCESSION NM_001194922 VERSION NM_001194922.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB663682.1, AK033657.1, AF349450.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are...
NM_001194922.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 18 (Cldn18), transcript variant A1.1, mRNA. (2842 bp)
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB663682.1, BX528145.1, AF221068.1, AC157949.1 and CF805431.1. On Aug 13, 2010 this sequence version replaced NM_019815.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
NM_019815.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Salmo salar Claudin-like protein ZF-A89 (cldy), mRNA. (1517 bp)
LOCUS NM_001141277 1517 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-like protein ZF-A89 (cldy), mRNA. ACCESSION NM_001141277 VERSION NM_001141277.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT048904.1. ##Evidence-Data-START## Transcript...
NM_001141277.1 - Salmo salar (Atlantic salmon) - NCBI
Mus musculus claudin 8 (Cldn8), mRNA. (2368 bp)
lus claudin 8 (Cldn8), mRNA. ACCESSION NM_018778 VERSION NM_018778.3 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK133810.1 and BE133033.1. On Nov 15, 2007 this sequence version replaced NM_018778.2. Summary: This intronless gene encodes a member of the claudin family. Claudins...
Synonym: AI648025
NM_018778.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Salmo salar Claudin-14 (cld14), mRNA. (1872 bp)
LOCUS NM_001140323 1872 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar Claudin-14 (cld14), mRNA. ACCESSION NM_001140323 VERSION NM_001140323.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BT045650.1. ##Evidence-Data-START## Transcript exon combination...
NM_001140323.1 - Salmo salar (Atlantic salmon) - NCBI
Bos taurus claudin 19 (CLDN19), mRNA. (1728 bp)
note="upstream in-frame stop codon" CDS 186..821 /gene="CLDN19" /codon_start=1 /product="claudin-19" /protein_id="NP_001094554.1" /db_xref="BGD:BT15781" /db_xref="GeneID:513034" /db_xref="VGNC:VGNC:27409" /translation="MANSGLQLLGYFLAMGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALEGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWAAAGLALLGGSFLCCTCPEPERANNSPQPYRPGPSTAAREYV" misc_feature 195..692 /gene="CLDN19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN // REFERENCE 1...
NM_001101084.1 - Bos taurus (cattle) - NCBI
Bos taurus claudin 16 (CLDN16), mRNA. (2887 bp)
IF: Claudin-16 sequences were not usually amplified from a small number of sperm cells ( or =50 cells) were present. REFERENCE 2 (bases 1 to 2887) AUTHORS Zimin AV, Delcher AL, Florea L, Kelley DR, Schatz MC, Puiu D, Hanrahan F, Pertea G, Van Tassell CP, Sonstegard TS, Marcais G, Roberts M, Subramanian P, Yorke JA and Salzberg SL. TITLE A whole-genome assembly of the domestic cow, Bos taurus JOURNAL Genome Biol. 10 (4), R42 (2009) PUBMED 19393038 REFERENCE 3 (bases 1 to 2887) AUTHORS Sugiyama A, Ozaki K, Miyazaki, Tanabe Y, Takeuchi T and Narama I. TITLE Renal dysplasia unrelated to claudin-16...
NM_174519.2 - Bos taurus (cattle) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/claudin
lang : en | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.138 | 0.138 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.288 | 0.151 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.295 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]