GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2018-06-23 22:45:30, GGRNA.v2 : RefSeq release 88 (May, 2018)

LOCUS       NM_001133960            3502 bp    mRNA    linear   PRI 01-APR-2018
DEFINITION  Pongo abelii claudin 12 (CLDN12), mRNA.
ACCESSION   NM_001133960
VERSION     NM_001133960.1
KEYWORDS    RefSeq.
SOURCE      Pongo abelii (Sumatran orangutan)
  ORGANISM  Pongo abelii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Pongo.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CR859386.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CR859386.1, CR557419.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..3502
                     /organism="Pongo abelii"
                     /mol_type="mRNA"
                     /db_xref="taxon:9601"
                     /chromosome="7"
                     /map="7"
     gene            1..3502
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /note="claudin 12"
                     /db_xref="GeneID:100174503"
     exon            2..84
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /inference="alignment:Splign:2.1.0"
     exon            85..174
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /inference="alignment:Splign:2.1.0"
     exon            175..3491
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    181..183
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /note="upstream in-frame stop codon"
     CDS             208..942
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /codon_start=1
                     /product="claudin-12"
                     /protein_id="NP_001127432.1"
                     /db_xref="GeneID:100174503"
                     /translation="
MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT"
     misc_feature    238..300
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5R9K1.1);
                     transmembrane region"
     misc_feature    469..531
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5R9K1.1);
                     transmembrane region"
     misc_feature    613..675
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5R9K1.1);
                     transmembrane region"
     misc_feature    730..792
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5R9K1.1);
                     transmembrane region"
     misc_feature    889..891
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000250|UniProtKB:P56749};
                     propagated from UniProtKB/Swiss-Prot (Q5R9K1.1);
                     phosphorylation site"
     misc_feature    898..900
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine. {ECO:0000250|UniProtKB:P56749};
                     propagated from UniProtKB/Swiss-Prot (Q5R9K1.1);
                     phosphorylation site"
     STS             296..540
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107123"
                     /db_xref="UniSTS:431920"
     STS             520..756
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107124"
                     /db_xref="UniSTS:431921"
     STS             700..952
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107125"
                     /db_xref="UniSTS:431922"
     STS             817..1718
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="ECD00552"
                     /db_xref="UniSTS:281662"
     STS             929..1172
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107126"
                     /db_xref="UniSTS:431923"
     STS             1136..1360
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107127"
                     /db_xref="UniSTS:431924"
     STS             1200..2253
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="stSG614603"
                     /db_xref="UniSTS:450490"
     STS             1249..1503
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107128"
                     /db_xref="UniSTS:431925"
     STS             1703..1953
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107130"
                     /db_xref="UniSTS:431927"
     STS             1755..2655
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="ECD00648"
                     /db_xref="UniSTS:281757"
     STS             2190..2452
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107132"
                     /db_xref="UniSTS:431929"
     STS             2234..3357
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="stSG614604"
                     /db_xref="UniSTS:450491"
     STS             2451..2721
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107133"
                     /db_xref="UniSTS:431930"
     STS             2696..2944
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107134"
                     /db_xref="UniSTS:431931"
     STS             3131..3358
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="REN107136"
                     /db_xref="UniSTS:431933"
     STS             3206..3357
                     /gene="CLDN12"
                     /gene_synonym="Claudin-12"
                     /standard_name="RH47948"
                     /db_xref="UniSTS:37396"
ORIGIN      
ggcacttcctgggacgctgagagggagacgctccaagaggctcctcagtgtgggcgagtaaaatgccctgcgtgtgagaagcaggctcagattattgctactctgtattcagatctgcatgtgtttcttctaagctgaataaagctgttttggaactgtcaggtacctcaaaggtctgactgacagcactccgcaagcttgcctgccatgggctgtcgggatgtccacgcagccacagtcctttccttcctgtgtggaatcgcctcagtagcaggcctctttgcagggactctgcttcccaactggagaaaattacgattgatcacattcaacagaaacgagaagaacctgactgtttacacaggcctgtgggtgaaatgtgcccggtatgacgggagcagtgactgcctgatgtacgacactacttggtactcatcagttgaccagctggacctgcgtgtcctccagtttgccctacccctcagcatgctgatcgccatgggtgccctgctgctgtgcctgattggaatgtgcaacactgccttcaggtcctcagtgcccaacatcaaactggccaagtgtctggtcaatagtgcaggttgccacctggtggctgggctgctgtttttcctggcaggtactgtgagcctctcgccatctatctgggtcatcttttataacatccatctgaacaagaagtttgagccagtcttttcatttgactatgcagtgtatgtcactattgctagtgctgggggcctgtttatgacttcccttatactgtttatttggtattgtacatgcaaatctttgccttctcctttctggcaaccattgtactcccatccacccagtatgcatacttactcacagccctattcagcacgctctcgcctctctgccattgaaattgacattccggtagtttcacacaccacttaatggggaaatagttaattgttaaagaaaacttcttgtagcctcacattccccttgtgcaaagagctcttttggacctacatacattttcctttgtttttgaccaatcaatgaagccaaatttgtatgtcctagtagaatgaagtgctgctagtttttatgagaagtacattatattaaatgtgaatttttttaattttgcttcttatactggaaggaattttagccttcatattgatatctaattaattatttaagtggaagaggcctgcatcacaattgaggtaatttagagcaacatgttaaagaatgatggttagcagaagctgttgcataccatcttcatgaatatttcagtgtgtatttttctttttctataatacctttaactgcaaagaaaaggcagtttcagatataagaaatttatttcaggtaagggtaatattttaatagtagtcaataatctagcttaaggctgtaactcttctcttggggctaattgtatgaataggtgtcagtatgttgaagattactttcttttgtgactttcttctacctcatgccagtgtttaaaagtaaaatgtattttaaatgatgttagaataagactaccattctaaatatcacctacttatgaataacatgtaataatttttaacattaatgattccataaattgtattattggggttagaatgtgctttatgacaggttagtatttcctctgaggcagaaaactcttttttggagatattatccatcaagcagtactcgtgcccatatgcaatctcttagtggctaagagaaataaataaaagggccataatggtttgttctctttcagacataatttagtaggggacaagaagtctgttcttcagtgactacactagagatttactctggtgactgccttttgagttatgggtgaagtaaggtatggctttaccataaccttgattcattcacccttgatgcatttctcgcccccatcactgattatttccttgagcatatatttttgcctaactaacactttagtaggtgctatagaggatacatgaaaagtatgagatctggtcccatccagtaagacattttaatagagaagatcaaaatgttacctgacagttggggaataatctgacttcattgtcagttggccttaacttcttaatcattgatccaggaatatttcaaccagagacacaagtttctgtcagacagacaaattgtacaacaccaacaatatcctggaccttgaaattctgtttacttcagtccattgtatccttaaggcacctgtgctagcctagattttgtaataacactgatttatgagaatgggcaaaagtggtagggaaattgttccctctccacttctgaaagtatgatgatgtattaaggatggaggagttattaaaaatgtctcttctgatgaggtaacaattagatgaaaccatgttaaaactgagatgaacacttagaaattcagggatattgggtcgttagccttatgaatttgagctgcttatttaattggtgtaatttgctacatattagtactatattcataaggatttttttattaaccattgcagattttacaaacagctagttatatggtaaacagattattatgcctttttgcaattctgaatatgattctagtatttgtgtggatgtatttggtactttttcccctaattccaacactagtttatatatagagcaaataaatctagttgtataaatttttaaatgccgtcagtagaaagcacacaaggttatgatttttttaattactggcttctgatttctttcacttctgatccttttcgtttttctcagatgtagctgagtcttgatcattttaagacaacgatgggtagaattttgagattaatattaattttttccctttttgttaatttcagtcccctctcactatgcttttgtccagaaggatcaagaattctaccatcccttgggtctttgtgtataaacaatgttaaataaaggtagactcagtctttaacatattagacagttttttagtccatgggattgtaaatataaacattaactttcctataagaatcttttggctttgtaatctatagccccaaattggtatttattatggattcactagacaaacagctgtttccttattgtcttttttctttagtgtttctgatttgctatcagtagctatttttaaagccatcaaaggaaaataattatttacagtttttgaagtcacttttgagccctcatcaagctctcattgtgatgggagggatacctttttgttgttaaaagcctattattgttgaaggccttttatggaaaccaacttggaaaacaaccttaaacgtggatgtatcagatttggtttatccagccgtgggagagaaaacaaacctaagtttactttacttgtacatatacactataatggatagtatatttgctgtaaactacaatgtaaaacctcaataaaagtgcactgtacttcttaatgtttattaaaagatgtatttttacaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]