GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 04:49:40, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001307               1542 bp    mRNA    linear   PRI 09-FEB-2020
DEFINITION  Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA.
ACCESSION   NM_001307
VERSION     NM_001307.6
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1542)
  AUTHORS   Kyuno D, Zhao K, Schnolzer M, Provaznik J, Hackert T and Zoller M.
  TITLE     Claudin7-dependent exosome-promoted reprogramming of
            nonmetastasizing tumor cells
  JOURNAL   Int. J. Cancer 145 (8), 2182-2200 (2019)
   PUBMED   30945750
  REMARK    GeneRIF: Results how that cancer-initiating cell (CIC) -tumor
            exosomes (TEX) rescue Claudin7 (cld7)-knockdown (kd) (cld7kd) tumor
            progression.
REFERENCE   2  (bases 1 to 1542)
  AUTHORS   Zhou S, Piao X, Wang C, Wang R and Song Z.
  TITLE     Identification of claudin1, 3, 7 and 8 as prognostic markers in
            human laryngeal carcinoma
  JOURNAL   Mol Med Rep 20 (1), 393-400 (2019)
   PUBMED   31115553
  REMARK    GeneRIF: the findings of the present study demonstrated that the
            expression levels of CLDN1, 3, 7 and 8 varied between laryngeal
            squamous carcinoma tissues and nonneoplastic tissues
REFERENCE   3  (bases 1 to 1542)
  AUTHORS   Wang K, Li T, Xu C, Ding Y, Li W and Ding L.
  TITLE     Claudin-7 downregulation induces metastasis and invasion in
            colorectal cancer via the promotion of epithelial-mesenchymal
            transition
  JOURNAL   Biochem. Biophys. Res. Commun. 508 (3), 797-804 (2019)
   PUBMED   30528239
  REMARK    GeneRIF: Decreasing expression of Claudin-7 may promote the
            invasion and metastasis of colorectal cancer by regulating
            epithelial-mesenchymal transition.
REFERENCE   4  (bases 1 to 1542)
  AUTHORS   Okui N, Kamata Y, Sagawa Y, Kuhara A, Hayashi K, Uwagawa T, Homma S
            and Yanaga K.
  TITLE     Claudin 7 as a possible novel molecular target for the treatment of
            pancreatic cancer
  JOURNAL   Pancreatology 19 (1), 88-96 (2019)
   PUBMED   30416041
  REMARK    GeneRIF: CLDN7 may be expressed in the rapidly proliferating and
            dominant cell population in human pancreatic cancer tissues.
REFERENCE   5  (bases 1 to 1542)
  AUTHORS   Li Y, Gong Y, Ning X, Peng D, Liu L, He S, Gong K, Zhang C, Li X
            and Zhou L.
  TITLE     Downregulation of CLDN7 due to promoter hypermethylation is
            associated with human clear cell renal cell carcinoma progression
            and poor prognosis
  JOURNAL   J. Exp. Clin. Cancer Res. 37 (1), 276 (2018)
   PUBMED   30428910
  REMARK    GeneRIF: Authors have demonstrated a previously undescribed role of
            CLDN7 as a ccRCC suppressor and suggest that loss of CLDN7
            potentiates EMT and tumor progression.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1542)
  AUTHORS   Heiskala M, Peterson PA and Yang Y.
  TITLE     The roles of claudin superfamily proteins in paracellular transport
  JOURNAL   Traffic 2 (2), 93-98 (2001)
   PUBMED   11247307
  REMARK    Review article
REFERENCE   7  (bases 1 to 1542)
  AUTHORS   Kniesel U and Wolburg H.
  TITLE     Tight junctions of the blood-brain barrier
  JOURNAL   Cell. Mol. Neurobiol. 20 (1), 57-76 (2000)
   PUBMED   10690502
  REMARK    Review article
REFERENCE   8  (bases 1 to 1542)
  AUTHORS   Itoh M, Furuse M, Morita K, Kubota K, Saitou M and Tsukita S.
  TITLE     Direct binding of three tight junction-associated MAGUKs, ZO-1,
            ZO-2, and ZO-3, with the COOH termini of claudins
  JOURNAL   J. Cell Biol. 147 (6), 1351-1363 (1999)
   PUBMED   10601346
REFERENCE   9  (bases 1 to 1542)
  AUTHORS   Morita K, Furuse M, Fujimoto K and Tsukita S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 96 (2), 511-516 (1999)
   PUBMED   9892664
REFERENCE   10 (bases 1 to 1542)
  AUTHORS   Peacock RE, Keen TJ and Inglehearn CF.
  TITLE     Analysis of a human gene homologous to rat ventral prostate.1
            protein
  JOURNAL   Genomics 46 (3), 443-449 (1997)
   PUBMED   9441748
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CV575841.1, AC003688.1 and
            BC071844.1.
            On Nov 23, 2018 this sequence version replaced NM_001307.5.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. Differential expression of this gene has been
            observed in different types of malignancies, including breast
            cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors,
            prostate cancer, lung cancer, head and neck cancers, thyroid
            carcinomas, etc.. Alternatively spliced transcript variants
            encoding different isoforms have been found.[provided by RefSeq,
            May 2010].
            
            Transcript Variant: This variant (1) encodes the longer isoform
            (1).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC071844.1, ERR279844.320.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1968540, SAMEA2142348
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000360325.11/ ENSP00000353475.7
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1                 CV575841.1         468-468
            2-658               AC003688.1         64217-64873         c
            659-823             AC003688.1         63217-63381         c
            824-1542            BC071844.1         629-1347
FEATURES             Location/Qualifiers
     source          1..1542
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17p13.1"
     gene            1..1542
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="claudin 7"
                     /db_xref="GeneID:1366"
                     /db_xref="HGNC:HGNC:2049"
                     /db_xref="MIM:609131"
     exon            1..658
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="alignment:Splign:2.1.0"
     variation       5
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1309920638"
     variation       8
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:762972726"
     variation       14
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1000420016"
     variation       21
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1335534256"
     variation       22
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1359104349"
     variation       27
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:905641068"
     variation       37
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310568522"
     variation       44
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1394081659"
     variation       45
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1295133566"
     variation       50
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889202651"
     variation       57
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044531057"
     variation       64
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027706191"
     variation       69
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1278997029"
     variation       71
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1441792056"
     variation       73
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1208586581"
     variation       74
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:949790613"
     variation       75
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458095622"
     variation       82
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254118451"
     variation       85
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773234630"
     variation       90
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376553754"
     variation       98
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995260452"
     variation       99
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1181800749"
     variation       100
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1362276395"
     variation       114
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1479093250"
     variation       116
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916921495"
     variation       123
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:865833864"
     variation       130
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036626442"
     variation       131
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1433435698"
     variation       139
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:940964473"
     variation       140
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567596601"
     variation       143
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:908114304"
     variation       152
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1371923766"
     variation       154
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:897803569"
     variation       161
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333633689"
     variation       162
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438106745"
     variation       170
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275249313"
     variation       176
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036597111"
     variation       178
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1232050496"
     variation       183
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1421012498"
     variation       185
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:562531705"
     variation       190
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1204534727"
     variation       191
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:545836584"
     variation       194
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:906746495"
     variation       197
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199803833"
     variation       199
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1246532586"
     variation       216
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1045209455"
     variation       217
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1191119142"
     variation       222
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:985003077"
     variation       227
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1269908688"
     variation       229
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145562713"
     variation       232
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1429607739"
     variation       236
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488265614"
     variation       237
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1166830837"
     variation       240
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393643322"
     variation       253
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:915656521"
     variation       263
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1263922341"
     variation       266
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1370049768"
     variation       273
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438432933"
     variation       280..281
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:554859335"
     variation       295
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:935687985"
     variation       302
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:922082071"
     variation       306
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1354505613"
     variation       311
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1249727512"
     variation       312
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1358522429"
     variation       318..320
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="t"
                     /replace="ttt"
                     /db_xref="dbSNP:1286573700"
     variation       329
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:924286331"
     variation       335..338
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="ctcc"
                     /db_xref="dbSNP:977368556"
     variation       336
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333980478"
     variation       341
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:975237626"
     variation       346
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764443909"
     variation       347
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376253030"
     variation       349..353
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="tt"
                     /replace="ttctt"
                     /db_xref="dbSNP:1248981146"
     variation       351
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467469613"
     variation       352
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356023821"
     variation       357
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1449425277"
     variation       358
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1168830543"
     variation       360
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:966086571"
     variation       362
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775710738"
     variation       365
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1430082081"
     variation       369
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759574089"
     variation       372
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185564333"
     variation       373
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:770858925"
     variation       375
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200696657"
     variation       378
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1481834990"
     variation       381
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459497098"
     variation       387
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1322329322"
     variation       388
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748120999"
     variation       389
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1196370484"
     variation       390
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1316917980"
     misc_feature    391..393
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="upstream in-frame stop codon"
     variation       393
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1381619953"
     variation       394
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1263285416"
     variation       395
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781238084"
     variation       397
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768594838"
     variation       399..402
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:56219105"
     variation       399
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300547900"
     variation       401
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1293325573"
     variation       402
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141537294"
     variation       404
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199606116"
     variation       406
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1433492809"
     variation       407
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1375278270"
     variation       409
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328969237"
     variation       410
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746781493"
     variation       411
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779894575"
     variation       412
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033330581"
     variation       416
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464633929"
     variation       419
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1377089790"
     variation       424
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758069878"
     variation       426
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778866641"
     variation       429
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421328771"
     variation       430
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347539363"
     variation       432
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1236803997"
     variation       433
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749963386"
     CDS             436..1071
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="isoform 1 precursor is encoded by transcript
                     variant 1; clostridium perfringens enterotoxin
                     receptor-like 2; epididymis secretory sperm binding
                     protein"
                     /codon_start=1
                     /product="claudin-7 isoform 1 precursor"
                     /protein_id="NP_001298.3"
                     /db_xref="CCDS:CCDS11096.1"
                     /db_xref="GeneID:1366"
                     /db_xref="HGNC:HGNC:2049"
                     /db_xref="MIM:609131"
                     /translation="
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV"
     sig_peptide     436..507
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    445..981
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; pfam00822"
                     /db_xref="CDD:250157"
     misc_feature    457..519
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95471.4);
                     transmembrane region"
     misc_feature    679..741
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95471.4);
                     transmembrane region"
     misc_feature    787..849
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95471.4);
                     transmembrane region"
     misc_feature    916..978
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95471.4);
                     transmembrane region"
     misc_feature    1063..1068
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95471.4);
                     Region: Interactions with TJP1, TJP2 and TJP3.
                     {ECO:0000250}"
     variation       439
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567596437"
     variation       441
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778496052"
     variation       443
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374655416"
     variation       446
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1201779323"
     variation       447
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764533562"
     variation       450
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761074982"
     variation       451
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1239689928"
     variation       452
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203949961"
     variation       453
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355767769"
     variation       457
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1258863306"
     variation       460
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753027850"
     variation       461
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1445726887"
     variation       462
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383199505"
     variation       473
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1014871951"
     variation       477
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767698459"
     variation       481
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759789750"
     variation       483
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1003791768"
     variation       492..494
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:771964031"
     variation       493
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160891664"
     variation       496
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35178249"
     variation       501
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1412501955"
     variation       502
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1455867340"
     variation       504
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774371364"
     variation       510
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771074161"
     variation       512
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11655844"
     variation       514
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1287114940"
     variation       516
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1411814278"
     variation       518
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763080763"
     variation       519
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1013971519"
     variation       525
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374957746"
     variation       528
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768686747"
     variation       530
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1254939116"
     variation       536
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1205196104"
     variation       542
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:574955449"
     variation       543
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283830501"
     variation       548..553
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="aca"
                     /replace="acaaca"
                     /db_xref="dbSNP:778664885"
     variation       549
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1239291208"
     variation       551
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:771710986"
     variation       552
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:745726375"
     variation       554
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:745535338"
     variation       561
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756811754"
     variation       568
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340093161"
     variation       569
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1045259550"
     variation       570
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:948237100"
     variation       573
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567596313"
     variation       575
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383974416"
     variation       579
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:893954266"
     variation       580
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748773256"
     variation       582
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1346355674"
     variation       598
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298150934"
     variation       599
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199539972"
     variation       603
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144545597"
     variation       605
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753117808"
     variation       606
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200335308"
     variation       611
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1367511929"
     variation       615
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569618349"
     variation       617
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:556173986"
     variation       618
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1186828683"
     variation       619
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766489545"
     variation       621
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374173666"
     variation       623
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376371298"
     variation       624
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466522162"
     variation       641
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773424587"
     variation       646
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373360250"
     variation       652
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760706346"
     variation       654
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775220631"
     variation       655
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:944320634"
     variation       656..657
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:771152939"
     variation       658
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1555533558"
     exon            659..823
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="alignment:Splign:2.1.0"
     variation       660
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1276524007"
     variation       663
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1019664423"
     variation       670
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1328383401"
     variation       674
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1352028474"
     variation       676
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:781744000"
     variation       677
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769041772"
     variation       683
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1376564183"
     variation       686
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:986873517"
     variation       687
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448217463"
     variation       691
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:954296922"
     variation       692
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1289972707"
     variation       693
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1567595878"
     variation       696..715
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="cctgg"
                     /replace="cctggtgctgggcttcctgg"
                     /db_xref="dbSNP:929702652"
     variation       696
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:560743926"
     variation       697
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149308129"
     variation       699
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:568192125"
     variation       700
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758773722"
     variation       703
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750701862"
     variation       706
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379386241"
     variation       707
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1184458638"
     variation       708
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1484353254"
     variation       711
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779224586"
     variation       714
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209469876"
     variation       715
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:547957587"
     variation       718
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757459277"
     variation       719
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:908450344"
     variation       724
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1305394346"
     variation       730
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758959441"
     variation       732
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144832882"
     variation       734
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373478236"
     variation       735
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762687113"
     variation       740
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772901497"
     variation       746
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1261083159"
     variation       749
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1476988508"
     variation       750
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769406740"
     variation       752
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761455420"
     variation       754
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1446617432"
     variation       757
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142682069"
     variation       758
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:867054456"
     variation       760
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1417726116"
     variation       761
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369146758"
     variation       762
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747479920"
     variation       763
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1425823001"
     variation       764
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1430383436"
     variation       766
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:568777982"
     variation       771
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746209260"
     variation       778
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1478207610"
     variation       779
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1265340892"
     variation       781
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215103064"
     variation       782
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779314588"
     variation       785
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757414858"
     variation       787
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754006543"
     variation       788
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1323190163"
     variation       790
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777728095"
     variation       791
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227322853"
     variation       796
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1335000948"
     variation       798
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756152576"
     variation       799
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1279530576"
     variation       802
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567595727"
     variation       803..804
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="gc"
                     /db_xref="dbSNP:1227140446"
     variation       817
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1398149433"
     variation       820
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:963756863"
     variation       822
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1339721273"
     exon            824..908
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="alignment:Splign:2.1.0"
     variation       825
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765023474"
     variation       826
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256012497"
     variation       829
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1344241984"
     variation       830
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1281072966"
     variation       831
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145020937"
     variation       832
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17849410"
     variation       838
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140980249"
     variation       840
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1300377957"
     variation       842
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1240571795"
     variation       843
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:763776370"
     variation       851
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:986821161"
     variation       852
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1329593155"
     variation       857
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760140090"
     variation       858
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201396194"
     variation       861
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1306434837"
     variation       863
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304661143"
     variation       864
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1455926691"
     variation       866
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1057085097"
     variation       869
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1377541554"
     variation       873
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151076113"
     variation       875
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760131614"
     variation       876
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1378781903"
     variation       881
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774931052"
     variation       885
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436849040"
     variation       886
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377295133"
     variation       889
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368954496"
     variation       894
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:921359121"
     variation       903
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143759813"
     variation       908
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148970901"
     exon            909..1542
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="alignment:Splign:2.1.0"
     variation       922
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478792995"
     variation       925
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1260973990"
     variation       927
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1192333333"
     variation       930
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368294497"
     variation       931
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328350299"
     variation       934
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1291690177"
     variation       935
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1340359693"
     variation       938
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1208347535"
     variation       941
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202218344"
     variation       943
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780943523"
     variation       944
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200203162"
     variation       945
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347087732"
     variation       948
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751075535"
     variation       949
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766852114"
     variation       951
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251355219"
     variation       954
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375656608"
     variation       956
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763527222"
     variation       957
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765618532"
     variation       958
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9912315"
     variation       959
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768840213"
     variation       962
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760815138"
     variation       966..968
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ggg"
                     /db_xref="dbSNP:1208885081"
     variation       970
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775629594"
     variation       972
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1321956225"
     variation       972
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749255717"
     variation       976
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337392258"
     variation       978
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766274868"
     variation       983
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1420752858"
     variation       984..985
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:751988367"
     variation       986
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777533955"
     variation       987
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769734637"
     variation       995
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478309213"
     variation       997
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374945200"
     variation       1001
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:747934368"
     variation       1002
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781058023"
     variation       1003
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371721675"
     variation       1005
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751114635"
     variation       1007
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779618547"
     variation       1008
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757803996"
     variation       1009
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1272301681"
     variation       1011
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1220368001"
     variation       1013
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750960349"
     variation       1015
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765708269"
     variation       1020..1031
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ccg"
                     /replace="ccgtgtaccccg"
                     /db_xref="dbSNP:766786518"
     variation       1020
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762201526"
     variation       1021
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149875713"
     variation       1022
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141055939"
     variation       1023
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750356848"
     variation       1025
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4562"
     variation       1028
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1327600201"
     variation       1030
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200370674"
     variation       1031
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773251272"
     variation       1035
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1453607281"
     variation       1036
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769849262"
     variation       1037
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1180753853"
     variation       1038..1040
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1567595367"
     variation       1038
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761984728"
     variation       1039
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748013881"
     variation       1040
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200825966"
     variation       1041
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3744400"
     variation       1046
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200179958"
     variation       1048
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1035730816"
     variation       1050
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1277163550"
     variation       1051
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139088043"
     variation       1053
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373668129"
     variation       1056
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:745334807"
     variation       1062
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150733809"
     variation       1064
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369723431"
     variation       1066
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754288281"
     variation       1068
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764449775"
     variation       1071
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756396409"
     variation       1088
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:767612596"
     variation       1089
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759702143"
     variation       1091
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376741365"
     variation       1092
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1160228957"
     variation       1094
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:931259883"
     variation       1098
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139056264"
     variation       1100
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761845015"
     variation       1101
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1039568345"
     variation       1102
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1473822214"
     variation       1103
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:942502314"
     variation       1105
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776668453"
     variation       1109
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:768516015"
     variation       1113
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1288656088"
     variation       1114
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1214873941"
     variation       1114
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:34184791"
     variation       1117
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775244828"
     variation       1119
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1470084160"
     variation       1123
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419179338"
     variation       1128
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:912352748"
     variation       1129
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001008709"
     variation       1142
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:554259644"
     variation       1143
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1021108252"
     variation       1144
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:537621453"
     variation       1147
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576047180"
     variation       1149
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1241889835"
     variation       1150
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:935031475"
     variation       1153
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1280651152"
     variation       1158
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1009749031"
     variation       1164
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746605493"
     variation       1165
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:557381253"
     variation       1166
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461141895"
     variation       1168
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:979486034"
     variation       1177
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:969023075"
     variation       1185..1188
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1200654189"
     variation       1189
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1166223809"
     variation       1190
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1405473579"
     variation       1191..1193
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:899819649"
     variation       1192
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1183636853"
     variation       1197
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:539027720"
     variation       1198
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1157045535"
     variation       1203
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:558388188"
     variation       1205
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435361730"
     variation       1207
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991653031"
     variation       1214
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1400246504"
     variation       1217..1235
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="gggt"
                     /replace="gggttgggggtgggggggt"
                     /db_xref="dbSNP:919678612"
     variation       1220
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393634741"
     variation       1227
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1555533340"
     variation       1228..1234
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ggggggg"
                     /replace="gggggggg"
                     /db_xref="dbSNP:941419766"
     variation       1228
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:958863304"
     variation       1229
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567595223"
     variation       1231
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1376587494"
     variation       1232
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1238469964"
     variation       1233
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306569051"
     variation       1234
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1035782629"
     variation       1238
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254896874"
     variation       1241..1246
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="tgg"
                     /replace="tggtgg"
                     /db_xref="dbSNP:1567595212"
     variation       1247..1252
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="gaga"
                     /replace="gagaga"
                     /db_xref="dbSNP:929144374"
     variation       1249
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983213973"
     variation       1262
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:538554683"
     variation       1263
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238754095"
     variation       1264
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457119418"
     variation       1266
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1176563872"
     variation       1267
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397052635"
     variation       1278
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1248697125"
     variation       1281
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:917787168"
     variation       1283
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1375977852"
     variation       1290
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1222348503"
     variation       1292
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1358832628"
     variation       1297
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1168959908"
     variation       1298
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:992476195"
     variation       1300
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1444953521"
     variation       1301
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1289754111"
     variation       1308
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959346215"
     variation       1310
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1243677637"
     variation       1312
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033743246"
     variation       1315
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386975834"
     variation       1317
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300223049"
     variation       1321..1324
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="cttc"
                     /replace="cttcttc"
                     /db_xref="dbSNP:1229010506"
     variation       1321
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1355817502"
     variation       1330
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:78296367"
     variation       1335
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1317231012"
     variation       1339
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:546663071"
     variation       1341
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1025666667"
     variation       1343
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:569905272"
     variation       1344
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760872164"
     variation       1345
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:530122257"
     variation       1346
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1190801195"
     variation       1353
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1294933004"
     variation       1354
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:898445156"
     variation       1362..1363
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35473892"
     variation       1362
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1430333819"
     variation       1368
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020722035"
     variation       1373
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1171494040"
     variation       1375
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1404970657"
     variation       1378
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464515135"
     variation       1379
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167807993"
     variation       1380
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040023623"
     variation       1386
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1006771157"
     variation       1387..1396
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ttcag"
                     /replace="ttcagttcag"
                     /db_xref="dbSNP:757950075"
     variation       1396
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1161206552"
     variation       1413
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1457752302"
     variation       1414
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1215"
     variation       1416
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:551101037"
     variation       1417
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:935083831"
     variation       1418
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:923669811"
     variation       1419
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1043431244"
     variation       1429
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900100787"
     variation       1436
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1216700220"
     variation       1442
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946368418"
     variation       1443
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1322060802"
     variation       1449
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220585287"
     variation       1452
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185269004"
     variation       1454
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1194739869"
     variation       1458
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262550233"
     variation       1459
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779497605"
     variation       1462
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1266822694"
     variation       1466
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1423548472"
     variation       1467
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:557697234"
     variation       1473
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1347388342"
     variation       1474
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958914936"
     variation       1477
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1567595082"
     variation       1478..1481
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:926572189"
     variation       1478
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937900774"
     variation       1479
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1489200425"
     variation       1481..1482
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1397628601"
     variation       1495
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:928820753"
     variation       1499
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1294999988"
     variation       1504..1509
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ctt"
                     /replace="cttctt"
                     /db_xref="dbSNP:1261270027"
     variation       1505..1510
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="tt"
                     /replace="ttcttt"
                     /db_xref="dbSNP:1227464068"
     variation       1506..1508
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="t"
                     /replace="tct"
                     /db_xref="dbSNP:1379823454"
     variation       1508..1513
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="ttt"
                     /replace="tttttt"
                     /db_xref="dbSNP:377718990"
     variation       1513
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1237970476"
     variation       1517..1523
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="aaaaaaa"
                     /replace="aaaaaaaa"
                     /db_xref="dbSNP:1285625284"
     variation       1522
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1303217687"
     variation       1524
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:565471914"
     variation       1525..1527
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1472757533"
     variation       1525
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1487325024"
     variation       1526
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1223748449"
     variation       1527
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:981552311"
     variation       1529
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:913606465"
     variation       1530
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:951524203"
     variation       1533
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1026141799"
ORIGIN      
gcccgcacctgctggctcacctccgagccacctctgctgcgcaccgcagcctcggacctacagcccaggatactttgggacttgccggcgctcagaaacgcgcccagacggcccctccaccttttgtttgcctagggtcgccgagagcgcccggagggaaccgcctggccttcggggaccaccaattttgtctggaaccaccctcccggcgtatcctactccctgtgccgcgaggccatcgcttcactggaggggtcgatttgtgtgtagtttggtgacaagatttgcattcacctggcccaaaccctttttgtctctttgggtgaccggaaaactccacctcaagttttcttttgtggggctgccccccaagtgtcgtttgttttactgtagggtctccccgcccggcgcccccagtgttttctgagggcggaaatggccaattcgggcctgcagttgctgggcttctccatggccctgctgggctgggtgggtctggtggcctgcaccgccatcccgcagtggcagatgagctcctatgcgggtgacaacatcatcacggcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcacggggatgatgagctgcaaaatgtacgactcggtgctcgccctgtccgcggccttgcaggccactcgagccctaatggtggtctccctggtgctgggcttcctggccatgtttgtggccacgatgggcatgaagtgcacgcgctgtgggggagacgacaaagtgaagaaggcccgtatagccatgggtggaggcataattttcatcgtggcaggtcttgccgccttggtagcttgctcctggtatggccatcagattgtcacagacttttataaccctttgatccctaccaacattaagtatgagtttggccctgccatctttattggctgggcagggtctgccctagtcatcctgggaggtgcactgctctcctgttcctgtcctgggaatgagagcaaggctgggtaccgtgtaccccgctcttaccctaagtccaactcttccaaggagtatgtgtgacctgggatctccttgccccagcctgacaggctatgggagtgtctagatgcctgaaagggcctggggctgagctcagcctgtgggcagggtgccggacaaaggcctcctggtcactctgtccctgcactccatgtatagtcctcttgggttgggggtgggggggtgccgttggtgggagagacaaaaagagggagagtgtgctttttgtacagtaataaaaaataagtattgggaagcaggcttttttcccttcagggcctctgctttcctcccgtccagatccttgcagggagcttggaaccttagtgcacctacttcagttcagaacacttagcaccccactgactccactgacaattgactaaaagatgcaggtgctcgtatctcgacattcattcccacccccctcttatttaaatagctaccaaagtacttcttttttaataaaaaaataaagatttttattaggta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]