GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:21:22, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_020293               1443 bp    mRNA    linear   ROD 01-OCT-2019
DEFINITION  Mus musculus claudin 9 (Cldn9), mRNA.
ACCESSION   NM_020293
VERSION     NM_020293.3
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1443)
  AUTHORS   Du TT, Dewey JB, Wagner EL, Cui R, Heo J, Park JJ, Francis SP,
            Perez-Reyes E, Guillot SJ, Sherman NE, Xu W, Oghalai JS, Kachar B
            and Shin JB.
  TITLE     LMO7 deficiency reveals the significance of the cuticular plate for
            hearing function
  JOURNAL   Nat Commun 10 (1), 1117 (2019)
   PUBMED   30850599
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1443)
  AUTHORS   Sharma RK, Chheda ZS, Das Purkayastha BP, Gomez-Gutierrez JG, Jala
            VR and Haribabu B.
  TITLE     A spontaneous metastasis model reveals the significance of
            claudin-9 overexpression in lung cancer metastasis
  JOURNAL   Clin. Exp. Metastasis 33 (3), 263-275 (2016)
   PUBMED   26669782
  REMARK    GeneRIF: These results suggest an essential role for claudin-9 in
            promoting lung cancer metastasis
REFERENCE   3  (bases 1 to 1443)
  AUTHORS   Lewandowski JP, Du F, Zhang S, Powell MB, Falkenstein KN, Ji H and
            Vokes SA.
  TITLE     Spatiotemporal regulation of GLI target genes in the mammalian limb
            bud
  JOURNAL   Dev. Biol. 406 (1), 92-103 (2015)
   PUBMED   26238476
REFERENCE   4  (bases 1 to 1443)
  AUTHORS   Street VA, Kujawa SG, Manichaikul A, Broman KW, Kallman JC,
            Shilling DJ, Iwata AJ, Robinson LC, Robbins CA, Li J, Liberman MC
            and Tempel BL.
  TITLE     Resistance to noise-induced hearing loss in 129S6 and MOLF mice:
            identification of independent, overlapping, and interacting
            chromosomal regions
  JOURNAL   J. Assoc. Res. Otolaryngol. 15 (5), 721-738 (2014)
   PUBMED   24952082
REFERENCE   5  (bases 1 to 1443)
  AUTHORS   Westmoreland JJ, Drosos Y, Kelly J, Ye J, Means AL, Washington MK
            and Sosa-Pineda B.
  TITLE     Dynamic distribution of claudin proteins in pancreatic epithelia
            undergoing morphogenesis or neoplastic transformation
  JOURNAL   Dev. Dyn. 241 (3), 583-594 (2012)
   PUBMED   22275141
REFERENCE   6  (bases 1 to 1443)
  AUTHORS   Abuazza G, Becker A, Williams SS, Chakravarty S, Truong HT, Lin F
            and Baum M.
  TITLE     Claudins 6, 9, and 13 are developmentally expressed renal tight
            junction proteins
  JOURNAL   Am. J. Physiol. Renal Physiol. 291 (6), F1132-F1141 (2006)
   PUBMED   16774906
  REMARK    GeneRIF: developmentally expressed claudin isoforms include claudin
            6, claudin 9, and claudin 13
REFERENCE   7  (bases 1 to 1443)
  AUTHORS   Hashizume A, Ueno T, Furuse M, Tsukita S, Nakanishi Y and Hieda Y.
  TITLE     Expression patterns of claudin family of tight junction membrane
            proteins in developing mouse submandibular gland
  JOURNAL   Dev. Dyn. 231 (2), 425-431 (2004)
   PUBMED   15366020
REFERENCE   8  (bases 1 to 1443)
  AUTHORS   Kitajiri SI, Furuse M, Morita K, Saishin-Kiuchi Y, Kido H, Ito J
            and Tsukita S.
  TITLE     Expression patterns of claudins, tight junction adhesion molecules,
            in the inner ear
  JOURNAL   Hear. Res. 187 (1-2), 25-34 (2004)
   PUBMED   14698084
  REMARK    GeneRIF: Claudin-9 is expressed at the variety of epithelial
            tissues in inner ear including Organ of Corti, stria vascularis,
            Reissner's membrane, spiral limbus, vestibular sensory epithelia,
            and dark cell area.
REFERENCE   9  (bases 1 to 1443)
  AUTHORS   Turksen K and Troy TC.
  TITLE     Permeability barrier dysfunction in transgenic mice overexpressing
            claudin 6
  JOURNAL   Development 129 (7), 1775-1784 (2002)
   PUBMED   11923212
REFERENCE   10 (bases 1 to 1443)
  AUTHORS   Morita K, Sasaki H, Fujimoto K, Furuse M and Tsukita S.
  TITLE     Claudin-11/OSP-based tight junctions of myelin sheaths in brain and
            Sertoli cells in testis
  JOURNAL   J. Cell Biol. 145 (3), 579-588 (1999)
   PUBMED   10225958
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC154766.2.
            On Aug 6, 2010 this sequence version replaced NM_020293.2.
            
            Summary: This intronless gene encodes a member of the claudin
            family. Claudins are integral membrane proteins and components of
            tight junction strands. Tight junction strands serve as a physical
            barrier to prevent solutes and water from passing freely through
            the paracellular space between epithelial or endothelial cell
            sheets, and also play critical roles in maintaining cell polarity
            and signal transductions. This gene is developmentally regulated;
            it is expressed in neonate kidney, but disappers by adulthood. It
            is required for the preservation of sensory cells in the hearing
            organ and the gene deficiency is associated with deafness.
            [provided by RefSeq, Aug 2010].
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: BC058186.1 [ECO:0000345]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1443              AC154766.2         9094-10536
FEATURES             Location/Qualifiers
     source          1..1443
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="17"
                     /map="17"
     gene            1..1443
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
                     /note="claudin 9"
                     /db_xref="GeneID:56863"
                     /db_xref="MGI:MGI:1913100"
     exon            1..1443
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    267..269
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
                     /note="upstream in-frame stop codon"
     CDS             378..1031
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
                     /codon_start=1
                     /product="claudin-9"
                     /protein_id="NP_064689.2"
                     /db_xref="CCDS:CCDS28458.1"
                     /db_xref="GeneID:56863"
                     /db_xref="MGI:MGI:1913100"
                     /translation="
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV"
     misc_feature    387..866
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:354884"
     misc_feature    414..476
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S7.2);
                     transmembrane region"
     misc_feature    621..683
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S7.2);
                     transmembrane region"
     misc_feature    726..788
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S7.2);
                     transmembrane region"
     misc_feature    855..917
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S7.2);
                     transmembrane region"
     regulatory      1422..1427
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
     polyA_site      1443
                     /gene="Cldn9"
                     /gene_synonym="nmf329"
ORIGIN      
agacgtcccaagtggcacctcacggttccctgttttgagacaagctgtataccagctgagagaagacttcaaccaagaaagtacgtgagcagccagcagagaggaacgcggttgttcctagttcatggcagatctggaggggctgtaatgggtgaaggcttccaggaggacacaagcaatacagatgagcgggacctaaggacttcttcgtattcagtgagtaccagatgtgtgagaggcccgcagctgtgaggtctggcctggtctgagatcaacagatccccctcctgagcagtgagacgcacccgaactccaacacagtgctcccaaccctattgagtgattcaggccaagagctgagaagacccgaggagcagatggcttccactggccttgaactcctcggcatgaccctggctgtgctaggctggctaggaactttggtgtcctgtgccctgccactgtggaaggtgaccgccttcatcggcaacagcatcgttgtggcccaagtggtatgggaggggctgtggatgtcctgtgtggtccagagcactggccagatgcagtgcaaagtatacgactcactgctggcgctgccccaggacctgcaggcagccagagccctctgtgtcgtggccctcctgctggctttgctgggcctgctggtggctatcacgggcgcccagtgcaccacgtgtgtggaggacgaaggtgccaaggcccgtatcgtactcaccgcaggggtcctcctcctcctctcgggcattttggtgctcatccctgtctgctggacagcccatgccatcatccaggatttttataacccactggttgcggaagccctcaagagagaactgggggcttccctctacctgggctgggctgccgctgccctgctcatgctagggggagggctcctctgctgtacgtgtcccccgtcacactttgagcgtccccgcggccccaggctgggctactccatcccttcccgttcaggtgcttcgggactggataagagggactatgtgtgaggctgaggcttcttccagaagcttccacctgcggcttcatgccctgcattgggctacatccttatatcatcaaatccatgcgcctgcgaagctcacttattggccaggacttggctcttaggggatctcagctggtctggcttgagctaaccctctgtagtggttgcaaccttgagaaagctccagttactgggtaccctgcttatcgctgcctcccaggattttgctgtggtttgctctcctggactttcttactctggaacctggacctcagcctccttgccttcaaagtaagatgtggactgtgacctaatactgaggctttagctggtcaagtctagcccaagcaccacctgaatccaagttactcagccccctaccctacctgtgaataaaagcacattgtaactga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]