2021-01-24 05:48:58, GGRNA.v2 : RefSeq release 203 (Nov, 2020)
LOCUS NM_001185023 1457 bp mRNA linear PRI 24-OCT-2020 DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. ACCESSION NM_001185023 VERSION NM_001185023.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1457) AUTHORS Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG, Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF, Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC, Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A, Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG, Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S, Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A, Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S, Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V, Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X, Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S, Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood MA. TITLE A reference map of the human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 2 (bases 1 to 1457) AUTHORS Kyuno D, Zhao K, Schnolzer M, Provaznik J, Hackert T and Zoller M. TITLE Claudin7-dependent exosome-promoted reprogramming of nonmetastasizing tumor cells JOURNAL Int J Cancer 145 (8), 2182-2200 (2019) PUBMED 30945750 REMARK GeneRIF: Results how that cancer-initiating cell (CIC) -tumor exosomes (TEX) rescue Claudin7 (cld7)-knockdown (kd) (cld7kd) tumor progression. REFERENCE 3 (bases 1 to 1457) AUTHORS Zhou J, Yang X, Zhou L, Zhang P and Wang C. TITLE Combined Immunohistochemistry for the 'Three 7' Markers (CK7, CD117, and Claudin-7) Is Useful in the Diagnosis of Chromophobe Renal Cell Carcinoma and for the Exclusion of Mimics: Diagnostic Experience from a Single Institution JOURNAL Dis Markers 2019, 4708154 (2019) PUBMED 31737127 REMARK GeneRIF: Claudin-7 is frequently expressed in the chromophobe renal cell carcinoma with high specificity. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1457) AUTHORS Tian JB, Cao L and Dong GL. TITLE Long noncoding RNA DDX11-AS1 induced by YY1 accelerates colorectal cancer progression through targeting miR-873/CLDN7 axis JOURNAL Eur Rev Med Pharmacol Sci 23 (13), 5714-5729 (2019) PUBMED 31298324 REMARK GeneRIF: Long noncoding RNA DDX11-AS1 induced by YY1 accelerates colorectal cancer progression through targeting miR-873/CLDN7 axis. REFERENCE 5 (bases 1 to 1457) AUTHORS Zhou S, Piao X, Wang C, Wang R and Song Z. TITLE Identification of claudin1, 3, 7 and 8 as prognostic markers in human laryngeal carcinoma JOURNAL Mol Med Rep 20 (1), 393-400 (2019) PUBMED 31115553 REMARK GeneRIF: the findings of the present study demonstrated that the expression levels of CLDN1, 3, 7 and 8 varied between laryngeal squamous carcinoma tissues and nonneoplastic tissues REFERENCE 6 (bases 1 to 1457) AUTHORS Heiskala M, Peterson PA and Yang Y. TITLE The roles of claudin superfamily proteins in paracellular transport JOURNAL Traffic 2 (2), 93-98 (2001) PUBMED 11247307 REMARK Review article REFERENCE 7 (bases 1 to 1457) AUTHORS Kniesel U and Wolburg H. TITLE Tight junctions of the blood-brain barrier JOURNAL Cell Mol Neurobiol 20 (1), 57-76 (2000) PUBMED 10690502 REMARK Review article REFERENCE 8 (bases 1 to 1457) AUTHORS Itoh M, Furuse M, Morita K, Kubota K, Saitou M and Tsukita S. TITLE Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins JOURNAL J Cell Biol 147 (6), 1351-1363 (1999) PUBMED 10601346 REFERENCE 9 (bases 1 to 1457) AUTHORS Morita K, Furuse M, Fujimoto K and Tsukita S. TITLE Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands JOURNAL Proc Natl Acad Sci U S A 96 (2), 511-516 (1999) PUBMED 9892664 REFERENCE 10 (bases 1 to 1457) AUTHORS Peacock RE, Keen TJ and Inglehearn CF. TITLE Analysis of a human gene homologous to rat ventral prostate.1 protein JOURNAL Genomics 46 (3), 443-449 (1997) PUBMED 9441748 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185023.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010]. Transcript Variant: This variant (3) lacks an exon in the 3' CDS, as compared to variant 1. The resulting isoform (2) has a shorter and distinct C-terminus, as compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1 CV575841.1 468-468 2-658 AC003688.1 64217-64873 c 659-823 AC003688.1 63217-63381 c 824-1450 AC003688.1 62306-62932 c 1451-1457 BC071844.1 1341-1347 FEATURES Location/Qualifiers source 1..1457 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17p13.1" gene 1..1457 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /note="claudin 7" /db_xref="GeneID:1366" /db_xref="HGNC:HGNC:2049" /db_xref="MIM:609131" exon 1..658 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /inference="alignment:Splign:2.1.0" misc_feature 391..393 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /note="upstream in-frame stop codon" CDS 436..873 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /note="isoform 2 precursor is encoded by transcript variant 3; clostridium perfringens enterotoxin receptor-like 2; epididymis secretory sperm binding protein" /codon_start=1 /product="claudin-7 isoform 2 precursor" /protein_id="NP_001171952.1" /db_xref="CCDS:CCDS54081.1" /db_xref="GeneID:1366" /db_xref="HGNC:HGNC:2049" /db_xref="MIM:609131" /translation="
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGMSLALPSLLAGQGLP"
sig_peptide 436..507 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 445..>831 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:389833" misc_feature 457..519 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /note="propagated from UniProtKB/Swiss-Prot (O95471.4); transmembrane region" misc_feature 679..741 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /note="propagated from UniProtKB/Swiss-Prot (O95471.4); transmembrane region" exon 659..823 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /inference="alignment:Splign:2.1.0" exon 824..1457 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /inference="alignment:Splign:2.1.0" regulatory 1200..1205 /regulatory_class="polyA_signal_sequence" /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /note="hexamer: AATAAA" polyA_site 1221 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /note="major polyA site" regulatory 1429..1434 /regulatory_class="polyA_signal_sequence" /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /note="hexamer: AATAAA" polyA_site 1457 /gene="CLDN7" /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359" /note="major polyA site" ORIGIN
gcccgcacctgctggctcacctccgagccacctctgctgcgcaccgcagcctcggacctacagcccaggatactttgggacttgccggcgctcagaaacgcgcccagacggcccctccaccttttgtttgcctagggtcgccgagagcgcccggagggaaccgcctggccttcggggaccaccaattttgtctggaaccaccctcccggcgtatcctactccctgtgccgcgaggccatcgcttcactggaggggtcgatttgtgtgtagtttggtgacaagatttgcattcacctggcccaaaccctttttgtctctttgggtgaccggaaaactccacctcaagttttcttttgtggggctgccccccaagtgtcgtttgttttactgtagggtctccccgcccggcgcccccagtgttttctgagggcggaaatggccaattcgggcctgcagttgctgggcttctccatggccctgctgggctgggtgggtctggtggcctgcaccgccatcccgcagtggcagatgagctcctatgcgggtgacaacatcatcacggcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcacggggatgatgagctgcaaaatgtacgactcggtgctcgccctgtccgcggccttgcaggccactcgagccctaatggtggtctccctggtgctgggcttcctggccatgtttgtggccacgatgggcatgaagtgcacgcgctgtgggggagacgacaaagtgaagaaggcccgtatagccatgggtggaggcataattttcatcgtggcaggtatgagtttggccctgccatctttattggctgggcagggtctgccctagtcatcctgggaggtgcactgctctcctgttcctgtcctgggaatgagagcaaggctgggtaccgtgtaccccgctcttaccctaagtccaactcttccaaggagtatgtgtgacctgggatctccttgccccagcctgacaggctatgggagtgtctagatgcctgaaagggcctggggctgagctcagcctgtgggcagggtgccggacaaaggcctcctggtcactctgtccctgcactccatgtatagtcctcttgggttgggggtgggggggtgccgttggtgggagagacaaaaagagggagagtgtgctttttgtacagtaataaaaaataagtattgggaagcaggcttttttcccttcagggcctctgctttcctcccgtccagatccttgcagggagcttggaaccttagtgcacctacttcagttcagaacacttagcaccccactgactccactgacaattgactaaaagatgcaggtgctcgtatctcgacattcattcccacccccctcttatttaaatagctaccaaagtacttcttttttaataaaaaaataaagatttttattaggta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]