GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-01-24 06:07:08, GGRNA.v2 : RefSeq release 203 (Nov, 2020)

LOCUS       NM_001265844            1630 bp    mRNA    linear   PRI 29-JUN-2020
DEFINITION  Macaca mulatta claudin 22 (CLDN22), mRNA.
ACCESSION   NM_001265844 XM_001092698
VERSION     NM_001265844.1
KEYWORDS    RefSeq.
SOURCE      Macaca mulatta (Rhesus monkey)
  ORGANISM  Macaca mulatta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
REFERENCE   1  (bases 1 to 1630)
  AUTHORS   Yan G, Zhang G, Fang X, Zhang Y, Li C, Ling F, Cooper DN, Li Q, Li
            Y, van Gool AJ, Du H, Chen J, Chen R, Zhang P, Huang Z, Thompson
            JR, Meng Y, Bai Y, Wang J, Zhuo M, Wang T, Huang Y, Wei L, Li J,
            Wang Z, Hu H, Yang P, Le L, Stenson PD, Li B, Liu X, Ball EV, An N,
            Huang Q, Zhang Y, Fan W, Zhang X, Li Y, Wang W, Katze MG, Su B,
            Nielsen R, Yang H, Wang J, Wang X and Wang J.
  TITLE     Genome sequencing and comparison of two nonhuman primate animal
            models, the cynomolgus and Chinese rhesus macaques
  JOURNAL   Nat. Biotechnol. 29 (11), 1019-1023 (2011)
   PUBMED   22002653
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from JU335044.1.
            On May 25, 2012 this sequence version replaced XM_001092698.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: JU335044.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1630
                     /organism="Macaca mulatta"
                     /mol_type="mRNA"
                     /db_xref="taxon:9544"
                     /chromosome="5"
                     /map="5"
     gene            1..1630
                     /gene="CLDN22"
                     /gene_synonym="claudin-22"
                     /note="claudin 22"
                     /db_xref="GeneID:701348"
     exon            1..1630
                     /gene="CLDN22"
                     /gene_synonym="claudin-22"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    537..539
                     /gene="CLDN22"
                     /gene_synonym="claudin-22"
                     /note="upstream in-frame stop codon"
     CDS             558..1217
                     /gene="CLDN22"
                     /gene_synonym="claudin-22"
                     /codon_start=1
                     /product="claudin-22"
                     /protein_id="NP_001252773.1"
                     /db_xref="GeneID:701348"
                     /translation="
MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVTQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGEGQRDLKRRLLILGGVLSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHALLASGHHAVAQMQDHHQLETRNTNLKN"
     misc_feature    585..1073
                     /gene="CLDN22"
                     /gene_synonym="claudin-22"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
ORIGIN      
ataagattgatttatttggttaagaaatacttttcttgaacctattttttaaaagtaacactcagtattaccataacatgcacatttgaaatgtgagaactataagagatgaaaatctgacaggtgcaattagtgagatacaaagcaggaggtgttgaaccaaaaccatcagttaaacattttgcattcagacttaattctttgttagaaaggttgggaataacaagaaagccattttaaccttaacaacgaaaggaggattattatcacttaattatatttcagtgacaaactgctttctgcaaaatccagcccacaggacacaaacacaatcttggccacaccttggcattactggtttgcagcattatttccctatccttttctgaaacccattcaacatggaatcaaacaatagcaactctggcaagaatcctcctatatacacaatgaagaaatatttctgagcttcataagttataacacaagtgtcacacttcttttcacagcaaccgaaggacaggagtttgtttggttaaagctctcaggacattataatggctttagtatttagaactgtggctcaactagctggagtttcattatctttgctgggatgggttttatcctgtcttacaaactacctgccacactggaagaacctcaacctggacttaaatgaaatggaaaactggaccatgggactctggcaaacctgcgtcacccaagaggaagtgggaatgcaatgcaaggactttgactccttcctggctttgcctgctgaactcagggtctccaggatcttaatgtttctatcaaacgggctgggatttctgggcctgctggtctctgggtttggcctggactgtttgagaattggagagggtcagagagatctcaagaggcgactgctgatcctgggaggagttctgtcctgggcctcgggaatcacagccctggttcctgtctcttgggttgcccacaagacggttcaggagttctgggatgagaacgtcccagactttgtccccaggtgggagtttggggaggccctctttctgggctggtttgctggactttctcttctactgggagggtgtctgctcaactgtgcagcctgttccagccacgctctcctagcttcgggccaccatgcagtggcgcaaatgcaagatcatcatcaactggagacaagaaacaccaacctgaaaaactaagccagaaaggacaagcgtctgctgctcaggagacgcttgctcaacactggatttggtaggaggtcctgctctagtcatctcactgtgcttctgattttcgaaaatgcattttttcctgtggctattaaactatagtttctttccaagactggtaaactatttttatcttctactctgagatcaaaaccaatcaagacttaatagtaatgacacccattactgtggatgagtgttctcaattttaaaacagtgattgcatagaagtggtaaataaaacgttaatctgtatgtgtctttgaaggtgttattcatatggagcggaatcatctggcagatcattgacttctttcaggtgtttaagataacctagtataataagcctgagctgcatatttatttaaaatgcatgacgt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]