ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-19 17:27:03, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001003089 953 bp mRNA linear MAM 28-APR-2025 DEFINITION Canis lupus familiaris claudin 2 (CLDN2), mRNA. ACCESSION NM_001003089 VERSION NM_001003089.1 KEYWORDS RefSeq. SOURCE Canis lupus familiaris (dog) ORGANISM Canis lupus familiaris Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis. REFERENCE 1 (bases 1 to 953) AUTHORS Sugawara,T., Furuse,K., Otani,T., Wakayama,T. and Furuse,M. TITLE Angulin-1 seals tricellular contacts independently of tricellulin and claudins JOURNAL J Cell Biol 220 (9) (2021) PUBMED 34269802 REMARK GeneRIF: Angulin-1 seals tricellular contacts independently of tricellulin and claudins. REFERENCE 2 (bases 1 to 953) AUTHORS Rosenthal,R., Gunzel,D., Piontek,J., Krug,S.M., Ayala-Torres,C., Hempel,C., Theune,D. and Fromm,M. TITLE Claudin-15 forms a water channel through the tight junction with distinct function compared to claudin-2 JOURNAL Acta Physiol (Oxf) 228 (1), e13334 (2020) PUBMED 31188544 REMARK GeneRIF: Claudin-15 forms a water channel through the tight junction with distinct function compared to claudin-2. REFERENCE 3 (bases 1 to 953) AUTHORS Fujii,N., Matsuo,Y., Matsunaga,T., Endo,S., Sakai,H., Yamaguchi,M., Yamazaki,Y., Sugatani,J. and Ikari,A. TITLE Hypotonic Stress-induced Down-regulation of Claudin-1 and -2 Mediated by Dephosphorylation and Clathrin-dependent Endocytosis in Renal Tubular Epithelial Cells JOURNAL J Biol Chem 291 (47), 24787-24799 (2016) PUBMED 27733684 REMARK GeneRIF: hypotonic stress induces dephosphorylation, clathrin-dependent endocytosis, and degradation of claudin-1 and -2 in lysosomes, resulting in disruption of the TJ barrier in renal tubular epithelial cells. REFERENCE 4 (bases 1 to 953) AUTHORS Ikari,A., Fujii,N., Hahakabe,S., Hayashi,H., Yamaguchi,M., Yamazaki,Y., Endo,S., Matsunaga,T. and Sugatani,J. TITLE Hyperosmolarity-Induced Down-Regulation of Claudin-2 Mediated by Decrease in PKCbeta-Dependent GATA-2 in MDCK Cells JOURNAL J Cell Physiol 230 (11), 2776-2787 (2015) PUBMED 25825272 REMARK GeneRIF: These results suggest that hyperosmolarity decreases the expression level of claudin-2 via a decrease in PKCbeta-dependent GATA-2 transcriptional activity in renal tubular epithelial cells REFERENCE 5 (bases 1 to 953) AUTHORS Tokuda,S. and Furuse,M. TITLE Claudin-2 knockout by TALEN-mediated gene targeting in MDCK cells: claudin-2 independently determines the leaky property of tight junctions in MDCK cells JOURNAL PLoS One 10 (3), e0119869 (2015) PUBMED 25781928 REMARK GeneRIF: Claudin-2 independently determines the 'leaky' property of Tight Junctions in MDCK II cells. Publication Status: Online-Only REFERENCE 6 (bases 1 to 953) AUTHORS Telgenhoff,D., Ramsay,S., Hilz,S., Slusarewicz,P. and Shroot,B. TITLE Claudin 2 mRNA and protein are present in human keratinocytes and may be regulated by all-trans-retinoic acid JOURNAL Skin Pharmacol Physiol 21 (4), 211-217 (2008) PUBMED 18509255 REMARK GeneRIF: The discovery of claudin 2 transcript and protein in the skin could be of importance in epidermal differentiation, barrier function and pathological conditions. REFERENCE 7 (bases 1 to 953) AUTHORS Ridyard,A.E., Brown,J.K., Rhind,S.M., Else,R.W., Simpson,J.W. and Miller,H.R. TITLE Apical junction complex protein expression in the canine colon: differential expression of claudin-2 in the colonic mucosa in dogs with idiopathic colitis JOURNAL J Histochem Cytochem 55 (10), 1049-1058 (2007) PUBMED 17595339 REMARK GeneRIF: Claudin-2 expression markedly increased in the proximal crypt and luminal colonic epithelium in affected dogs, suggesting a role in the pathogenesis of canine LPC. REFERENCE 8 (bases 1 to 953) AUTHORS Guillemot,L. and Citi,S. TITLE Cingulin regulates claudin-2 expression and cell proliferation through the small GTPase RhoA JOURNAL Mol Biol Cell 17 (8), 3569-3577 (2006) PUBMED 16723500 REMARK GeneRIF: These results provide novel insights about the mechanisms of cingulin function and the signaling pathways controlling claudin-2 expression in Madin-Darby canine kidney (MDCK) cells. REFERENCE 9 (bases 1 to 953) AUTHORS Lipschutz,J.H., Li,S., Arisco,A. and Balkovetz,D.F. TITLE Extracellular signal-regulated kinases 1/2 control claudin-2 expression in Madin-Darby canine kidney strain I and II cells JOURNAL J Biol Chem 280 (5), 3780-3788 (2005) PUBMED 15569684 REMARK GeneRIF: the ERK 1/2 signaling pathway negatively controls claudin-2 expression in mammalian renal epithelial cells and provide evidence for regulation of tight junction paracellular transport by alterations in claudin composition within tight junction complexes. REFERENCE 10 (bases 1 to 953) AUTHORS Furuse,M., Furuse,K., Sasaki,H. and Tsukita,S. TITLE Conversion of zonulae occludentes from tight to leaky strand type by introducing claudin-2 into Madin-Darby canine kidney I cells JOURNAL J Cell Biol 153 (2), 263-272 (2001) PUBMED 11309408 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF358907.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript is intronless :: AF358907.1, SRR10915301.2076305.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..953 /organism="Canis lupus familiaris" /mol_type="mRNA" /sub_species="familiaris" /db_xref="taxon:9615" /chromosome="X" /map="X" gene 1..953 /gene="CLDN2" /gene_synonym="Claudin-2" /note="claudin 2" /db_xref="GeneID:403649" /db_xref="RGD:12339905" /db_xref="VGNC:VGNC:39316" exon 1..953 /gene="CLDN2" /gene_synonym="Claudin-2" /inference="alignment:Splign:2.1.0" CDS 59..751 /gene="CLDN2" /gene_synonym="Claudin-2" /note="localizes to tight junctions; integral membrane protein claudin-2" /codon_start=1 /product="claudin-2" /protein_id="NP_001003089.1" /db_xref="GeneID:403649" /db_xref="RGD:12339905" /db_xref="VGNC:VGNC:39316" /translation="
MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVVGGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGYV"
misc_feature 80..142
/gene="CLDN2"
/gene_synonym="Claudin-2"
/note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
transmembrane region"
misc_feature 125..601
/gene="CLDN2"
/gene_synonym="Claudin-2"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
misc_feature 251..253
/gene="CLDN2"
/gene_synonym="Claudin-2"
/note="Paracellular cation selectivity.
/evidence=ECO:0000250|UniProtKB:O88552; propagated from
UniProtKB/Swiss-Prot (Q95KM6.1); other site"
misc_feature 302..364
/gene="CLDN2"
/gene_synonym="Claudin-2"
/note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
transmembrane region"
misc_feature 407..469
/gene="CLDN2"
/gene_synonym="Claudin-2"
/note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
transmembrane region"
misc_feature 545..607
/gene="CLDN2"
/gene_synonym="Claudin-2"
/note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
transmembrane region"
misc_feature 671..748
/gene="CLDN2"
/gene_synonym="Claudin-2"
/note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 713..715
/gene="CLDN2"
/gene_synonym="Claudin-2"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:O88552; propagated from
UniProtKB/Swiss-Prot (Q95KM6.1); phosphorylation site"
misc_feature 725..727
/gene="CLDN2"
/gene_synonym="Claudin-2"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:O88552; propagated from
UniProtKB/Swiss-Prot (Q95KM6.1); phosphorylation site"
misc_feature 743..748
/gene="CLDN2"
/gene_synonym="Claudin-2"
/note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
Region: Interaction with TJP1, TJP2 and TJP3.
/evidence=ECO:0000250"
ORIGIN
ctgcagcccggaaggcaaaggaacaagccctgaagacacttctgctgggaggtccgccatggcctctctcggcctccaacttgtaggctacatcctaggcctcctggggctgttgggcaccctggtggccatgctgcttcccagctggcgaacaagctcctacgttggtaccagcatcgtgacggcggtcggcttctccaagggcctctggatggagtgcgccacacacagcacaggcataacccagtgtgacatctacagcaccctcctaggcctgcctgctgacatccaggctgcccaggccatgatggtgacatccagtgcgatctcttcgttggcctgcattgtctctgtggtgggcatgagatgcactgtcttctgccaggactcccgagccaaagacagactggcggtggtgggtggagtcttcttcatcattggaggcctcctgggcttcatccccgttgcctggaaccttcacgggatcctgcgggacttctactccccgctggtacccgatagcatgaagttcgagatcggagaagctctctacctgggcattatttcctccttgttctccctggtagctggcatcatcctctgcttttcctgcccactccagggaaatcgctccgactactatgactcctaccaggcccagccccttgcaactagaggctctccaaggccgggtcaaccgcccaaagccaagagcgagtttaactcctacagcctgacagggtatgtgtgaagaaccaggggccagagctaggggggcggttggtggccgagtctgtgaaaaccagtgaacagcacctcccaaaccaccacccctggggccacaggtgagggacattggcactgtatcatgtcagaaggtgctgctgaggctagattgactttgcccactggatcaagtgaaggcagaaatgagaactggtgcaacagcatgc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]