GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-06 03:38:48, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001003089             953 bp    mRNA    linear   MAM 07-OCT-2024
DEFINITION  Canis lupus familiaris claudin 2 (CLDN2), mRNA.
ACCESSION   NM_001003089
VERSION     NM_001003089.1
KEYWORDS    RefSeq.
SOURCE      Canis lupus familiaris (dog)
  ORGANISM  Canis lupus familiaris
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;
            Canis.
REFERENCE   1  (bases 1 to 953)
  AUTHORS   Sugawara,T., Furuse,K., Otani,T., Wakayama,T. and Furuse,M.
  TITLE     Angulin-1 seals tricellular contacts independently of tricellulin
            and claudins
  JOURNAL   J Cell Biol 220 (9) (2021)
   PUBMED   34269802
  REMARK    GeneRIF: Angulin-1 seals tricellular contacts independently of
            tricellulin and claudins.
REFERENCE   2  (bases 1 to 953)
  AUTHORS   Rosenthal,R., Gunzel,D., Piontek,J., Krug,S.M., Ayala-Torres,C.,
            Hempel,C., Theune,D. and Fromm,M.
  TITLE     Claudin-15 forms a water channel through the tight junction with
            distinct function compared to claudin-2
  JOURNAL   Acta Physiol (Oxf) 228 (1), e13334 (2020)
   PUBMED   31188544
  REMARK    GeneRIF: Claudin-15 forms a water channel through the tight
            junction with distinct function compared to claudin-2.
REFERENCE   3  (bases 1 to 953)
  AUTHORS   Fujii,N., Matsuo,Y., Matsunaga,T., Endo,S., Sakai,H., Yamaguchi,M.,
            Yamazaki,Y., Sugatani,J. and Ikari,A.
  TITLE     Hypotonic Stress-induced Down-regulation of Claudin-1 and -2
            Mediated by Dephosphorylation and Clathrin-dependent Endocytosis in
            Renal Tubular Epithelial Cells
  JOURNAL   J Biol Chem 291 (47), 24787-24799 (2016)
   PUBMED   27733684
  REMARK    GeneRIF: hypotonic stress induces dephosphorylation,
            clathrin-dependent endocytosis, and degradation of claudin-1 and -2
            in lysosomes, resulting in disruption of the TJ barrier in renal
            tubular epithelial cells.
REFERENCE   4  (bases 1 to 953)
  AUTHORS   Ikari,A., Fujii,N., Hahakabe,S., Hayashi,H., Yamaguchi,M.,
            Yamazaki,Y., Endo,S., Matsunaga,T. and Sugatani,J.
  TITLE     Hyperosmolarity-Induced Down-Regulation of Claudin-2 Mediated by
            Decrease in PKCbeta-Dependent GATA-2 in MDCK Cells
  JOURNAL   J Cell Physiol 230 (11), 2776-2787 (2015)
   PUBMED   25825272
  REMARK    GeneRIF: These results suggest that hyperosmolarity decreases the
            expression level of claudin-2 via a decrease in PKCbeta-dependent
            GATA-2 transcriptional activity in renal tubular epithelial cells
REFERENCE   5  (bases 1 to 953)
  AUTHORS   Tokuda,S. and Furuse,M.
  TITLE     Claudin-2 knockout by TALEN-mediated gene targeting in MDCK cells:
            claudin-2 independently determines the leaky property of tight
            junctions in MDCK cells
  JOURNAL   PLoS One 10 (3), e0119869 (2015)
   PUBMED   25781928
  REMARK    GeneRIF: Claudin-2 independently determines the 'leaky' property of
            Tight Junctions in MDCK II cells.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 953)
  AUTHORS   Telgenhoff,D., Ramsay,S., Hilz,S., Slusarewicz,P. and Shroot,B.
  TITLE     Claudin 2 mRNA and protein are present in human keratinocytes and
            may be regulated by all-trans-retinoic acid
  JOURNAL   Skin Pharmacol Physiol 21 (4), 211-217 (2008)
   PUBMED   18509255
  REMARK    GeneRIF: The discovery of claudin 2 transcript and protein in the
            skin could be of importance in epidermal differentiation, barrier
            function and pathological conditions.
REFERENCE   7  (bases 1 to 953)
  AUTHORS   Ridyard,A.E., Brown,J.K., Rhind,S.M., Else,R.W., Simpson,J.W. and
            Miller,H.R.
  TITLE     Apical junction complex protein expression in the canine colon:
            differential expression of claudin-2 in the colonic mucosa in dogs
            with idiopathic colitis
  JOURNAL   J Histochem Cytochem 55 (10), 1049-1058 (2007)
   PUBMED   17595339
  REMARK    GeneRIF: Claudin-2 expression markedly increased in the proximal
            crypt and luminal colonic epithelium in affected dogs, suggesting a
            role in the pathogenesis of canine LPC.
REFERENCE   8  (bases 1 to 953)
  AUTHORS   Guillemot,L. and Citi,S.
  TITLE     Cingulin regulates claudin-2 expression and cell proliferation
            through the small GTPase RhoA
  JOURNAL   Mol Biol Cell 17 (8), 3569-3577 (2006)
   PUBMED   16723500
  REMARK    GeneRIF: These results provide novel insights about the mechanisms
            of cingulin function and the signaling pathways controlling
            claudin-2 expression in Madin-Darby canine kidney (MDCK) cells.
REFERENCE   9  (bases 1 to 953)
  AUTHORS   Lipschutz,J.H., Li,S., Arisco,A. and Balkovetz,D.F.
  TITLE     Extracellular signal-regulated kinases 1/2 control claudin-2
            expression in Madin-Darby canine kidney strain I and II cells
  JOURNAL   J Biol Chem 280 (5), 3780-3788 (2005)
   PUBMED   15569684
  REMARK    GeneRIF: the ERK 1/2 signaling pathway negatively controls
            claudin-2 expression in mammalian renal epithelial cells and
            provide evidence for regulation of tight junction paracellular
            transport by alterations in claudin composition within tight
            junction complexes.
REFERENCE   10 (bases 1 to 953)
  AUTHORS   Furuse,M., Furuse,K., Sasaki,H. and Tsukita,S.
  TITLE     Conversion of zonulae occludentes from tight to leaky strand type
            by introducing claudin-2 into Madin-Darby canine kidney I cells
  JOURNAL   J Cell Biol 153 (2), 263-272 (2001)
   PUBMED   11309408
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF358907.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: AF358907.1, SRR10915301.2076305.1
                                        [ECO:0000345]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..953
                     /organism="Canis lupus familiaris"
                     /mol_type="mRNA"
                     /sub_species="familiaris"
                     /db_xref="taxon:9615"
                     /chromosome="X"
                     /map="X"
     gene            1..953
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="claudin 2"
                     /db_xref="GeneID:403649"
                     /db_xref="VGNC:VGNC:39316"
     exon            1..953
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /inference="alignment:Splign:2.1.0"
     CDS             59..751
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="localizes to tight junctions; integral membrane
                     protein claudin-2"
                     /codon_start=1
                     /product="claudin-2"
                     /protein_id="NP_001003089.1"
                     /db_xref="GeneID:403649"
                     /db_xref="VGNC:VGNC:39316"
                     /translation="
MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVVGGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGYV"
     misc_feature    80..142
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
                     transmembrane region"
     misc_feature    125..601
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    251..253
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="Paracellular cation selectivity.
                     /evidence=ECO:0000250|UniProtKB:O88552; propagated from
                     UniProtKB/Swiss-Prot (Q95KM6.1); other site"
     misc_feature    302..364
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
                     transmembrane region"
     misc_feature    407..469
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
                     transmembrane region"
     misc_feature    545..607
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
                     transmembrane region"
     misc_feature    671..748
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    713..715
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:O88552; propagated from
                     UniProtKB/Swiss-Prot (Q95KM6.1); phosphorylation site"
     misc_feature    725..727
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:O88552; propagated from
                     UniProtKB/Swiss-Prot (Q95KM6.1); phosphorylation site"
     misc_feature    743..748
                     /gene="CLDN2"
                     /gene_synonym="Claudin-2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1);
                     Region: Interaction with TJP1, TJP2 and TJP3.
                     /evidence=ECO:0000250"
ORIGIN      
ctgcagcccggaaggcaaaggaacaagccctgaagacacttctgctgggaggtccgccatggcctctctcggcctccaacttgtaggctacatcctaggcctcctggggctgttgggcaccctggtggccatgctgcttcccagctggcgaacaagctcctacgttggtaccagcatcgtgacggcggtcggcttctccaagggcctctggatggagtgcgccacacacagcacaggcataacccagtgtgacatctacagcaccctcctaggcctgcctgctgacatccaggctgcccaggccatgatggtgacatccagtgcgatctcttcgttggcctgcattgtctctgtggtgggcatgagatgcactgtcttctgccaggactcccgagccaaagacagactggcggtggtgggtggagtcttcttcatcattggaggcctcctgggcttcatccccgttgcctggaaccttcacgggatcctgcgggacttctactccccgctggtacccgatagcatgaagttcgagatcggagaagctctctacctgggcattatttcctccttgttctccctggtagctggcatcatcctctgcttttcctgcccactccagggaaatcgctccgactactatgactcctaccaggcccagccccttgcaactagaggctctccaaggccgggtcaaccgcccaaagccaagagcgagtttaactcctacagcctgacagggtatgtgtgaagaaccaggggccagagctaggggggcggttggtggccgagtctgtgaaaaccagtgaacagcacctcccaaaccaccacccctggggccacaggtgagggacattggcactgtatcatgtcagaaggtgctgctgaggctagattgactttgcccactggatcaagtgaaggcagaaatgagaactggtgcaacagcatgc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]