GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-01-24 12:00:55, GGRNA : RefSeq release 209 (Nov, 2021)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Rattus norvegicus homeobox B2 (Hoxb2), mRNA. (1657 bp)
LOCUS NM_001047091 1657 bp mRNA linear ROD 02-OCT-2017 DEFINITION Rattus norvegicus homeobox B2 (Hoxb2), mRNA. ACCESSION NM_001047091 XM_001081296 XM_220894 VERSION NM_001047091.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 608..766 /gene="Hoxb2" /gene_synonym="Hoxbes2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1657) AUTHORS Jolma A, Yan J, Whitington T, Toivonen J,...
Synonym: Hoxbes2
NM_001047091.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus paired related homeobox 2 (Prrx2), mRNA. (1230 bp)
gene="Prrx2" /gene_synonym="Prx2" /codon_start=1 /product="paired mesoderm homeobox protein 2" /protein_id="NP_001099209.1" /db_xref="GeneID:113931" /db_xref="RGD:1311471" /translation="MDSAAAAFALDPPAPGPGPPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVPGPEAREGAAREPSGGSSGSEAAPQDGECAAPGHGSATKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTLSPDYLSWPASSPYSSVPPYSPGGSSPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN" misc_feature 464..622 /gene="Prrx2" /gene_synonym="Prx2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature <482..796 /gene="...
Synonym: Prx2
NM_001105739.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus mesenchyme homeobox 2 (Meox2), mRNA. (2247 bp)
LOCUS NM_017149 2247 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus mesenchyme homeobox 2 (Meox2), mRNA. ACCESSION NM_017149 VERSION NM_017149.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...Meox2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 760..921 /gene="Meox2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1027..1101 /gene="Meox2" /note="propagated from UniProtKB/Swiss-Prot...
NM_017149.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 5 (Lhx5), mRNA. (1890 bp)
LOCUS NM_139036 1890 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus LIM homeobox 5 (Lhx5), mRNA. ACCESSION NM_139036 VERSION NM_139036.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="Lhx5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 884..1048 /gene="Lhx5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(884..886,893..895,1013..1015,1022..1027,1034..1036) /gene="Lhx5" /note="specific DNA base...
NM_139036.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 6 (Lhx6), mRNA. (3421 bp)
LOCUS NM_001107837 3421 bp mRNA linear ROD 31-OCT-2021 DEFINITION Rattus norvegicus LIM homeobox 6 (Lhx6), mRNA. ACCESSION NM_001107837 XM_001079382 XM_231175 VERSION NM_001107837.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...gene="Lhx6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 817..978 /gene="Lhx6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 148..219 /gene="Lhx6" /inference="alignment:Splign:2.1.0" exon 220..402 /gene="...
NM_001107837.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box C12 (Hoxc12), mRNA. (843 bp)
FEATURES Location/Qualifiers source 1..843 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..843 /gene="Hoxc12" /note="homeo box C12" /db_xref="GeneID:300262" /db_xref="RGD:1310539" CDS 1..843 /gene="Hoxc12" /codon_start=1 /product="homeobox protein Hox-C12" /protein_id="NP_001100266.1" /db_xref="GeneID:300262" /db_xref="RGD:1310539" /translation="...
NM_001106796.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus UNC homeobox (Uncx), mRNA. (2388 bp)
LOCUS NM_017179 2388 bp mRNA linear ROD 03-JUL-2021 DEFINITION Rattus norvegicus UNC homeobox (Uncx), mRNA. ACCESSION NM_017179 XM_001065224 VERSION NM_017179.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 833..997 /gene="Uncx" /gene_synonym="Chx4; PHD1; Uncx4.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(833..835,842..844,962..964,971..976,983..985) /gene="Uncx" /gene_...
Synonym: Chx4; PHD1; Uncx4.1
NM_017179.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus mesenchyme homeobox 1 (Meox1), mRNA. (1871 bp)
LOCUS NM_001108837 1871 bp mRNA linear ROD 26-JUL-2021 DEFINITION Rattus norvegicus mesenchyme homeobox 1 (Meox1), mRNA. ACCESSION NM_001108837 XM_001081499 XM_343970 VERSION NM_001108837.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata...Meox1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..681 /gene="Meox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 1..463 /gene="Meox1" /inference="alignment:Splign:2.1.0" exon 464..639 /gene="Meox1" /...
NM_001108837.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus paired related homeobox 1 (Prrx1), mRNA. (1377 bp)
LOCUS NM_153821 1377 bp mRNA linear ROD 03-JUL-2021 DEFINITION Rattus norvegicus paired related homeobox 1 (Prrx1), mRNA. ACCESSION NM_153821 VERSION NM_153821.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...; Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 624..782 /gene="Prrx1" /gene_synonym="Pmx1; Prx-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(627..629,747..749,756..761,768..770) /gene="Prrx1" /gene_synonym="Pmx1;...
Synonym: Pmx1; Prx-1
NM_153821.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus BarH-like homeobox 1 (Barhl1), mRNA. (2392 bp)
LOCUS NM_057109 2392 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus BarH-like homeobox 1 (Barhl1), mRNA. ACCESSION NM_057109 VERSION NM_057109.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1304..1465 /gene="Barhl1" /gene_synonym="Barhl2; Mbh2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1667..1741 /gene="Barhl1" /gene_synonym="Barhl2; Mbh2" /note="propagated...
Synonym: Barhl2; Mbh2
NM_057109.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus dorsal root ganglia homeobox (Drgx), mRNA. (2403 bp)
LOCUS NM_145767 2403 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus dorsal root ganglia homeobox (Drgx), mRNA. ACCESSION NM_145767 VERSION NM_145767.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 387..548 /gene="Drgx" /gene_synonym="Drg11; Prrxl1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 540..683 /gene="Drgx" /gene_synonym="Drg11; Prrxl1" /note="propagated from...
Synonym: Drg11; Prrxl1
NM_145767.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus paired-like homeobox 2a (Phox2a), mRNA. (1608 bp)
LOCUS NM_053869 1608 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus paired-like homeobox 2a (Phox2a), mRNA. ACCESSION NM_053869 VERSION NM_053869.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 476..637 /gene="Phox2a" /gene_synonym="Arix" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 629..853 /gene="Phox2a" /gene_synonym="Arix" /note="propagated from UniProtKB/...
Synonym: Arix
NM_053869.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus pancreatic and duodenal homeobox 1 (Pdx1), mRNA. (1406 bp)
LOCUS NM_022852 1406 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus pancreatic and duodenal homeobox 1 (Pdx1), mRNA. ACCESSION NM_022852 VERSION NM_022852.4 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 570..734 /gene="Pdx1" /gene_synonym="Idx1; Ipf1; Stf1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(570..572,579..581,699..701,708..713,720..722) /gene="Pdx1" /gene_...
Synonym: Idx1; Ipf1; Stf1
NM_022852.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 1 (Lhx1), mRNA. (3390 bp)
LOCUS NM_145880 3390 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus LIM homeobox 1 (Lhx1), mRNA. ACCESSION NM_145880 VERSION NM_145880.4 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="Lhx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1147..1311 /gene="Lhx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(1147..1149,1156..1158,1276..1278,1285..1290, 1297..1299) /gene="Lhx1" /note="specific DNA...
NM_145880.4 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus NK6 homeobox 1 (Nkx6-1), mRNA. (3221 bp)
LOCUS NM_031737 3221 bp mRNA linear ROD 03-JUL-2021 DEFINITION Rattus norvegicus NK6 homeobox 1 (Nkx6-1), mRNA. ACCESSION NM_031737 XM_346455 VERSION NM_031737.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...from UniProtKB/Swiss-Prot (O35762.1); methylation site" misc_feature 1515..1679 /gene="Nkx6-1" /gene_synonym="Nkx6.1; Nkx61; Nkx6a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature 1680..1892 /gene="Nkx6-1" /gene_synonym="Nkx6.1; Nkx61; Nkx6a" /note="propagated...
Synonym: Nkx6.1; Nkx61; Nkx6a
NM_031737.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box D9 (Hoxd9), mRNA. (1834 bp)
Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="3" /map="3q23" gene 1..1834 /gene="Hoxd9" /note="homeo box D9" /db_xref="GeneID:688999" /db_xref="RGD:1582908" exon 1..859 /gene="Hoxd9" /inference="alignment:Splign:2.1.0" CDS 70..1101 /gene="Hoxd9" /note="homeobox Hox-D9" /codon_start=1 /product="homeobox protein Hox-D9" /protein_id="NP_001166940.1" /db_xref="GeneID:688999" /db_xref="RGD:1582908" /translation="...
NM_001173469.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus highly divergent homeobox (Hdx), transcript variant 2, mRNA. (9213 bp)
LOCUS NM_001395572 9213 bp mRNA linear ROD 20-JUL-2021 DEFINITION Rattus norvegicus highly divergent homeobox (Hdx), transcript variant 2, mRNA. ACCESSION NM_001395572 VERSION NM_001395572.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000430.1....
Synonym: RGD1563666
NM_001395572.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus highly divergent homeobox (Hdx), transcript variant 1, mRNA. (9360 bp)
LOCUS NM_001395571 9360 bp mRNA linear ROD 20-JUL-2021 DEFINITION Rattus norvegicus highly divergent homeobox (Hdx), transcript variant 1, mRNA. ACCESSION NM_001395571 XM_039099855 VERSION NM_001395571.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from...
Synonym: RGD1563666
NM_001395571.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus zinc fingers and homeoboxes 1 (Zhx1), mRNA. (4530 bp)
LOCUS NM_133620 4530 bp mRNA linear ROD 03-JUL-2021 DEFINITION Rattus norvegicus zinc fingers and homeoboxes 1 (Zhx1), mRNA. ACCESSION NM_133620 VERSION NM_133620.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JACYVU010000185.1. On Nov 26, 2020 this...
NM_133620.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus PBX homeobox 3 (Pbx3), mRNA. (2318 bp)
LOCUS NM_001107834 2318 bp mRNA linear ROD 09-AUG-2021 DEFINITION Rattus norvegicus PBX homeobox 3 (Pbx3), mRNA. ACCESSION NM_001107834 XM_001078717 XM_001078726 XM_001078743 XM_001078759 XM_231158 VERSION NM_001107834.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was...
NM_001107834.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus POU class 3 homeobox 3 (Pou3f3), mRNA. (3127 bp)
LOCUS NM_138837 3127 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus POU class 3 homeobox 3 (Pou3f3), mRNA. ACCESSION NM_138837 VERSION NM_138837.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1282..1446 /gene="Pou3f3" /gene_synonym="Brn1; RHS1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(1282..1284,1291..1293,1411..1413,1420..1425, 1432..1434) /gene="Pou3f3" /...
Synonym: Brn1; RHS1
NM_138837.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus POU class 3 homeobox 2 (Pou3f2), mRNA. (5909 bp)
LOCUS NM_172085 5909 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus POU class 3 homeobox 2 (Pou3f2), mRNA. ACCESSION NM_172085 XM_001059735 XM_345510 VERSION NM_172085.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1145..1306 /gene="Pou3f2" /gene_synonym="Brn-2; oct-7; OTF-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1145..1147,1154..1156,1274..1276,1283..1288, 1295..1297) /gene="...
Synonym: Brn-2; oct-7; OTF-7
NM_172085.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus zinc fingers and homeoboxes 3 (Zhx3), mRNA. (9002 bp)
LOCUS NM_001047097 9002 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus zinc fingers and homeoboxes 3 (Zhx3), mRNA. ACCESSION NM_001047097 XM_001057189 XM_001068695 XM_001068743 XM_230811 VERSION NM_001047097.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was...
Synonym: Tix1
NM_001047097.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus POU class 3 homeobox 1 (Pou3f1), mRNA. (2981 bp)
LOCUS NM_138838 2981 bp mRNA linear ROD 02-JUL-2021 DEFINITION Rattus norvegicus POU class 3 homeobox 1 (Pou3f1), mRNA. ACCESSION NM_138838 VERSION NM_138838.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;..." /db_xref="CDD:238039" misc_feature 1061..1225 /gene="Pou3f1" /gene_synonym="Oct-6; Otf6; Scip; Testes-1; Tst-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(1061..1063,1070..1072,1190..1192,1199..1204, 1211..1213) /gene="Pou3f1" /...
Synonym: Oct-6; Otf6; Scip; Testes-1; Tst-1
NM_138838.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 21-JUN-2021 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence version replaced...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X1, mRNA. (2580 bp)
LOCUS XM_039103065 2580 bp mRNA linear ROD 21-JAN-2021 DEFINITION PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X1, mRNA. ACCESSION XM_039103065 VERSION XM_039103065.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
Synonym: Isl-1; isl-1=homeobox
XM_039103065.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X2, mRNA. (1414 bp)
LOCUS XM_039103066 1414 bp mRNA linear ROD 21-JAN-2021 DEFINITION PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X2, mRNA. ACCESSION XM_039103066 VERSION XM_039103066.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
Synonym: Isl-1; isl-1=homeobox
XM_039103066.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 05-FEB-2021 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000220.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus one cut homeobox 1 (Onecut1), mRNA. (2360 bp)
LOCUS NM_022671 2360 bp mRNA linear ROD 17-OCT-2021 DEFINITION Rattus norvegicus one cut homeobox 1 (Onecut1), mRNA. ACCESSION NM_022671 VERSION NM_022671.3 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JACYVU010000199.1. On Nov 27, 2020 this sequence...
Synonym: Hnf6
NM_022671.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 20-JUN-2021 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 9 (Rhox9), mRNA. (829 bp)
LOCUS NM_001024874 829 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus reproductive homeobox 9 (Rhox9), mRNA. ACCESSION NM_001024874 XM_216470 VERSION NM_001024874.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...Psx4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 468..629 /gene="Rhox9" /gene_synonym="Psx4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(468..470,477..479,597..599,606..611,618..620) /gene="Rhox9" /gene_synonym="...
Synonym: Psx4
NM_001024874.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 8 (Rhox8), mRNA. (738 bp)
LOCUS NM_001025776 738 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus reproductive homeobox 8 (Rhox8), mRNA. ACCESSION NM_001025776 XM_578961 VERSION NM_001025776.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...Rhox8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 361..519 /gene="Rhox8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..64 /gene="Rhox8" /inference="alignment:Splign:2.0.8" exon 65..440 /gene="Rhox8" /...
NM_001025776.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. (794 bp)
feature 58..60 /gene="Rhox5" /gene_synonym="Pem" /note="upstream in-frame stop codon" exon 94..175 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" CDS 97..723 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.2" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="...
Synonym: Pem
NM_022175.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H6 family homeobox 2 (Hmx2), mRNA. (1497 bp)
LOCUS NM_001106303 1497 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus H6 family homeobox 2 (Hmx2), mRNA. ACCESSION NM_001106303 XM_001054069 XM_215056 VERSION NM_001106303.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 546..710 /gene="Hmx2" /gene_synonym="RGD1565366" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(546..548,555..557,675..677,684..689,696..698) /gene="Hmx2" /gene_synonym="...
Synonym: RGD1565366
NM_001106303.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 10 (Rhox10), mRNA. (606 bp)
LOCUS NM_001037581 606 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus reproductive homeobox 10 (Rhox10), mRNA. ACCESSION NM_001037581 VERSION NM_001037581.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 295..444 /gene="Rhox10" /gene_synonym="Rhoxf10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 1..365 /gene="Rhox10" /gene_synonym="Rhoxf10" /inference="alignment:Splign:2.0.8"...
Synonym: Rhoxf10
NM_001037581.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H6 family homeobox 3 (Hmx3), mRNA. (1362 bp)
box 3" /codon_start=1 /product="homeobox protein HMX3" /protein_id="NP_001099772.1" /db_xref="GeneID:293537" /db_xref="RGD:1559927" /translation="MPEPGPDASGTASAPPPQPPPQPPAPKESPFSIRNLLNGDHHRPPPKPQPPPRTLFAPASKGALEGAAGFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPYTLTPAGGHLPRPEASEKALLRDSSPASGTDRDSPDPLLKADPDHKELDSKSPDEIILEESDSEEGKKEGEAVPGAAGTTVGATAATPGSEDWKAGADSPEKKPACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAAELEAANLSHAAAQRIVRVPILYHENSAAEGGAPVPVSQPLLTFPHPVYYSHPVVSSVPLLRPV" misc_feature 688..852 /gene="Hmx3" /gene_synonym="RGD1559927" /note="Homeobox domain; Region: Homeobox;...
Synonym: RGD1559927
NM_001106302.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3), mRNA. (908 bp)
LOCUS NM_001135607 908 bp mRNA linear ROD 16-MAR-2021 DEFINITION Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3), mRNA. ACCESSION NM_001135607 VERSION NM_001135607.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...Rhox3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 685..843 /gene="Rhox3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 401..764 /gene="Rhox3" /inference="alignment:Splign:2.1.0" exon 765..810 /gene="...
NM_001135607.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 4G (Rhox4g), mRNA. (829 bp)
LOCUS NM_001024889 829 bp mRNA linear ROD 16-MAR-2021 DEFINITION Rattus norvegicus reproductive homeobox 4G (Rhox4g), mRNA. ACCESSION NM_001024889 XM_233314 VERSION NM_001024889.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ058652.1. On Jun 17, 2005 this sequence...
NM_001024889.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus brain specific homeobox (Bsx), mRNA. (869 bp)
misc_feature 385..546 /gene="Bsx" /gene_synonym="RGD1565120" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 308..504 /gene="Bsx" /gene_synonym="RGD1565120" /inference="alignment:Splign:2.1.0" exon 505..869 /gene="Bsx" /gene_synonym="RGD1565120" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 869) AUTHORS Carstensen MB, Hertz H, Bering T, Moller M, Rohde K, Klein DC, Coon SL and Rath MF. TITLE Circadian regulation and molecular role of the Bsx homeobox gene in the adult pineal gland JOURNAL J Pineal Res 68 (2), e12629 (2020) PUBMED...
Synonym: RGD1565120
NM_001191995.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ladybird homeobox 2 (Lbx2), mRNA. (816 bp)
LOCUS NM_001109244 816 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus ladybird homeobox 2 (Lbx2), mRNA. ACCESSION NM_001109244 XM_001072452 XM_575575 VERSION NM_001109244.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 316..477 /gene="Lbx2" /gene_synonym="RGD1561172" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(316..318,325..327,445..447,454..459,466..468) /gene="Lbx2" /gene_synonym="...
Synonym: RGD1561172
NM_001109244.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus distal-less homeobox 4 (Dlx4), mRNA. (1629 bp)
duct="homeobox protein DLX-4" /protein_id="NP_001100510.1" /db_xref="GeneID:303469" /db_xref="RGD:1308744" /translation="MTSLPCPLPGLGPSNVVFPDLAPASSVVAAYQLGLSPGTAASPDLSFSQTYGHLLSYSYPGPATPGDSYLSSQQQSAAPSRPFHQPTEHPQELEAESEKLALSLEPSQPSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGELEEDFSGRPPSLSPHSLTLPSIWDLPKAGTLPTSGYDNSFGTWYQHHSPDVLALPQRM" misc_feature order(346..360,364..366,415..417,433..435,472..474, 478..483,490..495,499..507,511..516) /gene="Dlx4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 352..516 /gene="Dlx4" /note="Homeobox...
NM_001107040.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box B8 (Hoxb8), mRNA. (973 bp)
reference sequence was derived from JACYVU010000220.1. On Jul 17, 2010 this sequence version replaced XM_220888.4. Summary: mouse homolog is a homeobox transcription factor; involved in control of developmental pathways [RGD, Feb 2006]. Sequence Note: The RefSeq transcript and protein were derived...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 448..609 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" exon 1..424 /gene="Hoxb8" /gene_synonym="Hox2r1a" /inference="alignment:Splign:2.1.0" STS...
Synonym: Hox2r1a
NM_001191649.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox C8 (Hoxc8), mRNA. (1228 bp)
FEATURES Location/Qualifiers source 1..1228 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..1228 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox C8" /db_xref="GeneID:24460" /db_xref="RGD:2821" CDS 1..729 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox protein R4; Homeobox gene C8; homeo box C8" /codon_start=1 /product="homeobox protein Hox-C8" /protein_id="NP_001170797.2" /db_xref="GeneID:24460" /db_xref="RGD:2821" /translation="...
Synonym: Hox3r4
NM_001177326.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus GS homeobox 1 (Gsx1), mRNA. (786 bp)
N, Kambe F, Seo H, Oiso Y and Saito H. TITLE Homeobox protein Gsh-1-dependent regulation of the rat GHRH gene promoter JOURNAL Mol Endocrinol 15 (12), 2149-2156 (2001) PUBMED 11731616 REFERENCE 3 (bases 1 to 786) AUTHORS Li H, Zeitler PS, Valerius MT, Small K and Potter SS. TITLE Gsh-1, an orphan Hox gene, is required for normal pituitary development JOURNAL EMBO J 15 (4), 714-724 (1996) PUBMED 8631293 REFERENCE 4 (bases 1 to 786) AUTHORS Valerius MT, Li H, Stock JL, Weinstein M, Kaur S, Singh G and Potter SS. TITLE Gsh-1: a novel murine homeobox gene expressed in the central nervous system...
Synonym: Gsh1
NM_001191663.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Meis homeobox 3 (Meis3), mRNA. (1794 bp)
product="homeobox protein Meis3" /protein_id="NP_001101942.1" /db_xref="GeneID:361514" /db_xref="RGD:1308532" /translation="MARRYEEPRHYPGITEHTAALASFPEAAPSVPRAPGPYGPHRPPQPQGPGLDSDSLKREKDDIYGHPLFPLLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQIRSERPLFSSNPELDNLMVQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDLEDYAASCPSLPDQNTTWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGYTETQPHVTVRTPGSMGMNLNLEGEWHYL" misc_feature 490..741 /gene="Meis3" /gene_synonym="Mrg2" /note="N-terminal of Homeobox Meis and...
Synonym: Mrg2
NM_001108472.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box A5 (Hoxa5), mRNA. (2938 bp)
review. The reference sequence was derived from JACYVU010000142.1. On Oct 25, 2019 this sequence version replaced XM_003752180.2. Summary: homeobox transcription factor; may be important for pattern specification [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the...Hoxa5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 2419..2580 /gene="Hoxa5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:365835" exon 2387..2938 /gene="Hoxa5" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1...
NM_024389.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Rhox homeobox family member 11 (Rhox11), mRNA. (648 bp)
LOCUS NM_001024873 648 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus Rhox homeobox family member 11 (Rhox11), mRNA. ACCESSION NM_001024873 XM_233320 VERSION NM_001024873.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ058658.1. On Jun 17, 2005 this...
NM_001024873.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus NK2 homeobox 6 (Nkx2-6), mRNA. (1468 bp)
product="homeobox protein Nkx-2.6" /protein_id="NP_001121125.1" /db_xref="GeneID:364418" /db_xref="RGD:1306149" /translation="MDSNLVREPKTPPGTISPLGVENLMMEHGVGNRSDDPRRAGPVPTVTRPRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASVLQLTSTQVKIWFQNRRYKCKRQRQDQTLELAGHPLAPRRVAVPVLVLDVKPCLDPDRHAFPSPYATTVLYSCFSSYTGTPYSASYAGRYTGAGPGPLAPLASSGFSPGGQSAAPQGHLAATPQGVTA" misc_feature order(193..207,211..213,262..264,280..282,319..321, 325..330,337..342,346..354,358..363) /gene="Nkx2-6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 199..363 /gene="Nkx2-6" /note="Homeobox domain; Region:...
NM_001127653.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus BARX homeobox 1 (Barx1), mRNA. (1372 bp)
LOCUS NM_001108880 1372 bp mRNA linear ROD 01-FEB-2021 DEFINITION Rattus norvegicus BARX homeobox 1 (Barx1), mRNA. ACCESSION NM_001108880 XM_001056986 XM_344575 VERSION NM_001108880.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...gene="Barx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 516..677 /gene="Barx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(516..518,525..527,645..647,654..659,666..668) /gene="Barx1" /note="specific DNA base...
NM_001108880.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/rn/homeobox
lang : en | div : | spe : rn | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.077 | 0.077 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Rattus norvegicus (Norway rat)?to=0&format=json
0.135 | 0.058 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Rattus norvegicus (Norway rat)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.141 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]