2024-04-19 14:52:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001127653 1468 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus NK2 homeobox 6 (Nkx2-6), mRNA. ACCESSION NM_001127653 XM_001068954 XM_344429 VERSION NM_001127653.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1468) AUTHORS Wang J, Mao JH, Ding KK, Xu WJ, Liu XY, Qiu XB, Li RG, Qu XK, Xu YJ, Huang RT, Xue S and Yang YQ. TITLE A novel NKX2.6 mutation associated with congenital ventricular septal defect JOURNAL Pediatr Cardiol 36 (3), 646-656 (2015) PUBMED 25380965 REFERENCE 2 (bases 1 to 1468) AUTHORS Wang J, Zhang DF, Sun YM, Li RG, Qiu XB, Qu XK, Liu X, Fang WY and Yang YQ. TITLE NKX2-6 mutation predisposes to familial atrial fibrillation JOURNAL Int J Mol Med 34 (6), 1581-1590 (2014) PUBMED 25319568 REFERENCE 3 (bases 1 to 1468) AUTHORS Heathcote K, Braybrook C, Abushaban L, Guy M, Khetyar ME, Patton MA, Carter ND, Scambler PJ and Syrris P. TITLE Common arterial trunk associated with a homeodomain mutation of NKX2.6 JOURNAL Hum Mol Genet 14 (5), 585-593 (2005) PUBMED 15649947 REFERENCE 4 (bases 1 to 1468) AUTHORS Tanaka M, Schinke M, Liao HS, Yamasaki N and Izumo S. TITLE Nkx2.5 and Nkx2.6, homologs of Drosophila tinman, are required for development of the pharynx JOURNAL Mol Cell Biol 21 (13), 4391-4398 (2001) PUBMED 11390666 REFERENCE 5 (bases 1 to 1468) AUTHORS Biben C, Hatzistavrou T and Harvey RP. TITLE Expression of NK-2 class homeobox gene Nkx2-6 in foregut endoderm and heart JOURNAL Mech Dev 73 (1), 125-127 (1998) PUBMED 9545560 REFERENCE 6 (bases 1 to 1468) AUTHORS Tanaka M, Kasahara H, Bartunkova S, Schinke M, Komuro I, Inagaki H, Lee Y, Lyons GE and Izumo S. TITLE Vertebrate homologs of tinman and bagpipe: roles of the homeobox genes in cardiovascular development JOURNAL Dev Genet 22 (3), 239-249 (1998) PUBMED 9621431 REFERENCE 7 (bases 1 to 1468) AUTHORS Nikolova M, Chen X and Lufkin T. TITLE Nkx2.6 expression is transiently and specifically restricted to the branchial region of pharyngeal-stage mouse embryos JOURNAL Mech Dev 69 (1-2), 215-218 (1997) PUBMED 9486544 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC160896.1. On or before May 25, 2008 this sequence version replaced XM_344429.3, XM_001068954.1. ##Evidence-Data-START## Transcript exon combination :: BC160896.1, CK598451.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760383, SAMEA5760389 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1468 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="15" /map="15p11" gene 1..1468 /gene="Nkx2-6" /note="NK2 homeobox 6" /db_xref="GeneID:364418" /db_xref="RGD:1306149" exon 1..70 /gene="Nkx2-6" /inference="alignment:Splign:2.1.0" CDS 43..684 /gene="Nkx2-6" /codon_start=1 /product="homeobox protein Nkx-2.6" /protein_id="NP_001121125.1" /db_xref="GeneID:364418" /db_xref="RGD:1306149" /translation="
MDSNLVREPKTPPGTISPLGVENLMMEHGVGNRSDDPRRAGPVPTVTRPRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASVLQLTSTQVKIWFQNRRYKCKRQRQDQTLELAGHPLAPRRVAVPVLVLDVKPCLDPDRHAFPSPYATTVLYSCFSSYTGTPYSASYAGRYTGAGPGPLAPLASSGFSPGGQSAAPQGHLAATPQGVTA"
misc_feature 190..360 /gene="Nkx2-6" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(193..207,211..213,262..264,280..282,319..321, 325..330,337..342,346..354,358..363) /gene="Nkx2-6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(199..201,208..210,328..330,337..342,349..351) /gene="Nkx2-6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 71..1443 /gene="Nkx2-6" /inference="alignment:Splign:2.1.0" ORIGIN
gaagcaaccccttttctgtgcacctgggagacagtcctagagatggactcaaatcttgtgagggagccgaagactcccccgggcacaatctccccacttggagtcgagaacctgatgatggagcatggcgtgggcaaccggagcgacgacccgcgccgagctggccctgttccgaccgtgacccggccacggcggaagccccgcgtgctattttcgcaggcccaggtgctggccctggagcggcgcttcaagcagcagcgatacctgtctgcgccggagcgtgagcacttggccagtgtgctgcagctcacgtccacgcaggtcaagatctggttccaaaaccggcgctacaagtgcaagagacagcgccaggaccagaccctggaactggcgggccacccactagcaccgcgccgggtggcagtgcccgtacttgtactggacgtcaagccctgcctagatcccgacagacacgcattcccgagtccctacgcaaccaccgtgctctactcctgcttcagcagctacacaggcactccctacagcgctagctatgcgggccgctacaccggcgccggcccggggccacttgcaccgctggctagctctggcttcagcccaggtggccaaagtgcggccccgcagggccatttggccgctacgccacagggagtcacggcctagtgaaaaacctgggctcacctaccgacatcaggtgcctgatgcctgatgcctgatcccctccccttccacctgctcgccgcttggctggaaagccgcgatgggtctgcactgccggtcgtactgatctcgaaatgaactgtccggaggagcggcccctgcagaccttgagaacattctttccctcggagaagtaaccgtgctttggccagccacatagatgctgtgcagagagaatagcacagtggtggttgatagtttgggggcaggtgattctaaactacaattccttctaaactaatgcaacggcctcccttccaccccttaaaggaacgagccgagccggggttgaggggatgcgggggggggggggttgagagaaaaaggccagaccgttgagactgaccaaggaagtgccagacaggatttttattgccacccactctctgcaatgggtttaagcatagggacctttggaaacatccacaggctagcacttcccctggctgtgatcttgctttcaaaaggggcctcttcatttctccagtcaccttaactgcattttatgtagggaacagccagaccagtaaatgagctattcagtgtgcttgcgtgttagagccgccaagaccctcaagaagttctgttattctcaggagacccacacgggagaactggggagttggaggccaatctgcactaagtaaagaaaccctgcctgtatctaaagcaaaataaaatagacctagggagataaaaccaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]