GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-01-24 12:57:05, GGRNA : RefSeq release 209 (Nov, 2021)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Oryza sativa Japonica Group disease resistance protein PIK6-NP-like (LOC107281440), mRNA. (500 bp)
samples with support for all annotated introns" /db_xref="GeneID:107281440" CDS 168..467 /gene="LOC107281440" /codon_start=1 /product="disease resistance protein PIK6-NP-like" /protein_id="XP_015643813.1" /db_xref="GeneID:107281440" /translation="MAETVLSMARSLVGSAISKAASAAANETSLLLGVEKDIWYIKDELKTMQAFLRAAEVMKKKDELLKVWAEQIRDLSYDIEDSLMNLKSILKAKPYFVSW" misc_feature 243..>416 /gene="LOC107281440" /note="Coiled-coil domain of the potato virux X resistance protein and similar proteins; Region: RX-CC_like; cd14798" /db_xref="CDD:271353" ORIGIN //...
AA_position 42
XM_015788327.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group disease resistance protein PIK6-NP-like (LOC107281202), mRNA. (2222 bp)
samples with support for all annotated introns" /db_xref="GeneID:107281202" CDS 1512..2075 /gene="LOC107281202" /codon_start=1 /product="disease resistance protein PIK6-NP-like" /protein_id="XP_015642059.1" /db_xref="GeneID:107281202" /translation="MAETVLSMARSLVGSAISKATSAAAHEASLLLGVQKDIWYIKDELKTMQAFLRAAEVMKKKDELLKVWAEQIRDLSYDIEDCLDEFKVHIESQNLFYQMVKLRKRHLIATQIRNLKSRVEEVSSRNSRYNLVKPISSSNEDDMDCYAEDIRNQSTSNVDETELVGFSDSKIRLLELISANVIMVQPK" misc_feature 1542..1883 /gene="LOC107281202" /note="Coiled-coil domain of the potato virux X resistance protein and similar proteins; Region: RX-CC_like;...
AA_position 42
XM_015786573.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC4346387 (LOC4346387), mRNA. (688 bp)
feature by RNAseq alignments, including 96 samples with support for all annotated introns" /db_xref="GeneID:4346387" CDS 160..387 /gene="LOC4346387" /codon_start=1 /product="uncharacterized protein LOC4346387" /protein_id="XP_015612568.1" /db_xref="GeneID:4346387" /translation="MSSTNTTSNDPKTTKDELAPPAPTAAEHGGGKDAVTKTVQTVEVKESVGQEPVLKPTKVVHQIPADQAKDAPKQD" ORIGIN //...
AA_position 15
XM_015757082.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group thioredoxin H-type (LOC4339267), mRNA. (734 bp)
introns" /db_xref="GeneID:4339267" CDS 164..529 /gene="LOC4339267" /codon_start=1 /product="thioredoxin H-type" /protein_id="XP_015640796.1" /db_xref="GeneID:4339267" /translation="MAAASAAAQAEGTVIAIHSLDEWTIQIEEANSAKKLVVIDFTASWCGPCRIIAPVFADLAKKHTNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAMKDELASKLELHMAM" misc_feature 239..511 /gene="LOC4339267" /note="TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the...
AA_position 108
XM_015785310.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group sm-like protein LSM1B (LOC4335963), mRNA. (990 bp)
support for all annotated introns" /db_xref="GeneID:4335963" CDS 235..624 /gene="LOC4335963" /codon_start=1 /product="sm-like protein LSM1B" /protein_id="XP_015633580.1" /db_xref="GeneID:4335963" /translation="MSSWAGPDEIFLSTSLAGFLDKKLIVLLRDGRKLLGTLCSFDQFANVVLQGACERVIVGELYCDVPLGLYVIRGENVVLIGELDREKDELPAHMTCVSEAEIRKAEKAEREARDLKGSMRKRMEFLDFD" misc_feature 271..483 /gene="LOC4335963" /note="Like-Sm protein 1; Region: LSm1; cd01728" /db_xref="CDD:212475" ORIGIN //...
AA_position 87
XM_015778094.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group thioredoxin H2-2-like (LOC4334453), mRNA. (745 bp)
introns" /db_xref="GeneID:4334453" CDS 121..525 /gene="LOC4334453" /codon_start=1 /product="thioredoxin H2-2" /protein_id="XP_015631704.1" /db_xref="GeneID:4334453" /translation="MGSFFSTMFTPPPAADDGGDSRVVAVHSTATWDEQWGAHKSNPNKLIVIDFSATWCGPCRFIEPAFKDMAGRFADAVFFKIDVDELSEVARQWKVEAMPTFVLIKGGKEVSRVVGAKKDELERKVNMFI" misc_feature 250..498 /gene="LOC4334453" /note="TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter...
AA_position 118
XM_015776218.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group thioredoxin H2-1-like (LOC4342618), mRNA. (709 bp)
introns" /db_xref="GeneID:4342618" CDS 36..452 /gene="LOC4342618" /codon_start=1 /product="thioredoxin H2-1" /protein_id="XP_015646978.1" /db_xref="GeneID:4342618" /translation="MGGAFSTSKPKPAAGEEGGESAVVAVHSKAKWDELWDAHKNTTKLVVIDFSASWCGPCKMMEPVFKEMAGRFTDVAFLKVDVDELAEVARTWRVEAMPTFVLARGGEEVGRIVGADKDELEKTINTLRTATTT" misc_feature 141..410 /gene="LOC4342618" /note="TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter...
AA_position 117
XM_015791492.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group E3 ubiquitin-protein ligase MARCH2 (LOC4324432), transcript variant X3, mRNA. (1271 bp)
support for all annotated introns" /db_xref="GeneID:4324432" CDS 297..734 /gene="LOC4324432" /codon_start=1 /product="E3 ubiquitin-protein ligase MARCH2 isoform X3" /protein_id="XP_015627663.1" /db_xref="GeneID:4324432" /translation="MRRDAAAVPTAAVASPPISVEAVVIDVEGDPAVPAGAACRICHLVPEGGVGPGSEVIRIGCGCKDELGAAHRHCAEAWFRIKGDRRCEICGSDAKNIIGLEVKKFMEEWHGPRLANTRTTTQRVSALFLVSTYTSVYLYWFDFNG" misc_feature 411..569 /gene="LOC4324432" /note="RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-...
AA_position 64
XM_015772177.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group E3 ubiquitin-protein ligase MARCH2 (LOC4324432), transcript variant X2, mRNA. (1989 bp)
support for all annotated introns" /db_xref="GeneID:4324432" CDS 297..767 /gene="LOC4324432" /codon_start=1 /product="E3 ubiquitin-protein ligase MARCH2 isoform X2" /protein_id="XP_015627656.1" /db_xref="GeneID:4324432" /translation="MRRDAAAVPTAAVASPPISVEAVVIDVEGDPAVPAGAACRICHLVPEGGVGPGSEVIRIGCGCKDELGAAHRHCAEAWFRIKGDRRCEICGSDAKNIIGLEVKKFMEEWHGPRLANTRTTTQRVSALFLVSTYTRYMLLPSIPPDYSSYVMSSLRC" misc_feature 411..569 /gene="LOC4324432" /note="RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace...
AA_position 64
XM_015772170.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group E3 ubiquitin-protein ligase MARCH2 (LOC4324432), transcript variant X1, mRNA. (3238 bp)
support for all annotated introns" /db_xref="GeneID:4324432" CDS 289..759 /gene="LOC4324432" /codon_start=1 /product="uncharacterized protein LOC4324432 isoform X1" /protein_id="XP_025876550.1" /db_xref="GeneID:4324432" /translation="MRRDAAAVPTAAVASPPISVEAVVIDVEGDPAVPAGAACRICHLVPEGGVGPGSEVIRIGCGCKDELGAAHRHCAEAWFRIKGDRRCEICGSDAKNIIGLEVKKFMEEWHGPRLANTRTTTQRESTCWRTQPFCNFLLACLLIAFMLPWFLRVNMF" misc_feature 397..>756 /gene="LOC4324432" /note="E3 ubiquitin-protein ligase DOA10 [Posttranslational modification, protein turnover, chaperones]; Region: SSM4; COG5183" /db_xref="CDD:227510" misc_feature...
AA_position 64
XM_026020765.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC107278287 (LOC107278287), transcript variant X4, mRNA. (2911 bp)
all annotated introns" /db_xref="GeneID:107278287" CDS 551..1033 /gene="LOC107278287" /codon_start=1 /product="uncharacterized protein LOC107278287 isoform X2" /protein_id="XP_025878045.1" /db_xref="GeneID:107278287" /translation="MSLEPASPSADSGVTSLTSTANNVAVVVRGGDSDDSDDSDSSDGVGYDSDDLMDDMMDDIFEQFIEKDELLDRIGARLVAPLLPAATRAQRRQVLEQREQARAAREELRRGVARSRELTRKIRRLKRMANADVSGYPAARREAHERETRRLAREIFGSDA" misc_feature 734..>997 /gene="LOC107278287" /note="Herpesvirus UL25 family; Region: Herpes_UL25; cl28129" /db_xref="CDD:332950" ORIGIN //...
AA_position 67
XM_026022260.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC107278287 (LOC107278287), transcript variant X3, mRNA. (7106 bp)
all annotated introns" /db_xref="GeneID:107278287" CDS 142..624 /gene="LOC107278287" /codon_start=1 /product="uncharacterized protein LOC107278287 isoform X2" /protein_id="XP_025878044.1" /db_xref="GeneID:107278287" /translation="MSLEPASPSADSGVTSLTSTANNVAVVVRGGDSDDSDDSDSSDGVGYDSDDLMDDMMDDIFEQFIEKDELLDRIGARLVAPLLPAATRAQRRQVLEQREQARAAREELRRGVARSRELTRKIRRLKRMANADVSGYPAARREAHERETRRLAREIFGSDA" ORIGIN //...
AA_position 67
XM_026022259.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group auxin-binding protein 4 (LOC107277066), mRNA. (651 bp)
LOC107277066" /codon_start=1 /product="auxin-binding protein 4" /protein_id="XP_025877817.1" /db_xref="GeneID:107277066" /translation="MCHQSWLERVLTVSGVCSDNSVVKDIRQMPQGTLAHGMKEVEVCLQTFGPGQRTPIHRHSCEEVFVVLKGKGTLFLGSSSMKYPGQPQEIPVFQNSTFTIPVNDPHQVWNSDEHEDLQVIVVISRPPIKVFFYDDWNMPHTAAKLQFPIFWDEECLIAPKDEL" misc_feature 214..648 /gene="LOC107277066" /note="Conserved domain found in cupin and related proteins; Region: cupin_like; cl21464" /db_xref="CDD:328732" ORIGIN //...
AA_position 160
XM_026022032.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC4346979 (LOC4346979), mRNA. (859 bp)
introns" /db_xref="GeneID:4346979" CDS 76..570 /gene="LOC4346979" /codon_start=1 /product="uncharacterized protein LOC4346979" /protein_id="XP_015610774.1" /db_xref="GeneID:4346979" /translation="MASSSLLRSAGGALRRWIPRRLFPSTSYRVWFGRRQSGYEQAFAESPRRRHLGSDCGGSTDDNQKRYSMDELLKCKRQLEKNKEGAFRPADIPDHESKKDELYRKMRSTFDKLCHCLDEQEHILREIEDQVDNDEKFDQVKQYLVAIPSFVCIGLILDRMHMFG" ORIGIN //...
AA_position 99
XM_015755288.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC4343647 (LOC4343647), mRNA. (737 bp)
db_xref="GeneID:4343647" CDS 58..561 /gene="LOC4343647" /codon_start=1 /product="uncharacterized protein LOC4343647" /protein_id="XP_015645640.1" /db_xref="GeneID:4343647" /translation="MHLRFVPFPAIAVGGASLRFLADNTRAVGGSGRRRCSDVVAFSSSEKGPGPGSGEEREPRAEEALRRLAELDSQLEGLSEPRERPPAPPLPPDPYMDRDMITGRGSKDELPEFSPTYVTFSTLALVILTIFTNVVFNLYIKPSVDGVDQPVRIERVPMVNPADQQFK" ORIGIN //...
AA_position 107
XM_015790154.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC4352144 (LOC4352144), mRNA. (1302 bp)
codon_start=1 /product="uncharacterized protein LOC4352144" /protein_id="XP_015618673.1" /db_xref="GeneID:4352144" /translation="MGADRKSSSPAGKPAEAARAGSLLAGLPSRGNFVADSIASSMGGLPVYVCLHDTAPPEGQVIDTDTTNILIRSLQLSKQKNEAKDVGSRTPGESSKGKRSASRLLDGKNPSKRANTGSTAGSSAHGELGSVFSEQTLQSFTVEKLRILLKERGLSPKGKKDELIARLIESSE" misc_feature 288..464 /gene="LOC4352144" /note="Det1 complexing ubiquitin ligase; Region: DDA1; pfam10172" /db_xref="CDD:401980" misc_feature 414..>740 /gene="LOC4352144" /note="poly [ADP-ribose] polymerase; Provisional; Region: PLN03124" /db_xref="CDD:215591" misc_feature 633..731 /gene="...
AA_position 166
XM_015763187.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC4330520 (LOC4330520), mRNA. (1191 bp)
Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:4330520" CDS 278..829 /gene="LOC4330520" /codon_start=1 /product="uncharacterized protein LOC4330520" /protein_id="XP_015626789.1" /db_xref="GeneID:4330520" /translation="MATILENIQKARFLPTRPLKDELPTFQKESHLMGLRKRLSSFSDKIQPISSASAEWAFRRSKSAPSLGAFAGGPLKRWWDWGVGWLMSKKPGFATDLEMNEEEVAALGRGSRGSWGHILYKMRSGVRRLVTSHSLPTTHRSASAQCKPAATFNYTQSFHSGQTAMAY" ORIGIN //...
AA_position 20
XM_015771303.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC4334723 (LOC4334723), transcript variant X1, mRNA. (1166 bp)
db_xref="GeneID:4334723" CDS 333..887 /gene="LOC4334723" /codon_start=1 /product="uncharacterized protein LOC4334723" /protein_id="XP_015628199.1" /db_xref="GeneID:4334723" /translation="MAALRYAARKICGRALQRPRVVYPAVTSPALEAERRLLPMLIRGEMPHISYTRHFSSSATPQPPLANNNKSISGHRLPCPNPAADAKVHNNIDPASLETLVQEKKDELFRLLLQMDLHNGSCEKSAEENKAILRLLRQFRAETRDNGTLSGADTKNLANRYVLPVSIILSGIIIVAQGHFISHL" ORIGIN //...
AA_position 105
XM_015772713.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group ADP-ribosylation factor-like protein 5 (LOC4350802), mRNA. (1027 bp)
db_xref="GeneID:4350802" CDS 233..787 /gene="LOC4350802" /codon_start=1 /product="ADP-ribosylation factor-like protein 5" /protein_id="XP_015615163.1" /db_xref="GeneID:4350802" /translation="MGAWMSRVWFLMFPAKEYKIVVVGLDNAGKTTTLYKLHLGEAVTAAPTIGSNVEEVVFKNIRFEVWDLGGQESLRTSWATYYRGTHAVIVVIDSTDRARINIIKDELFRLLQHGDLEGAVVLVFANKQDLKDAMSPAEITDALSLHSIKNHDWHIQASCAITGEGLYDGLGWIAQKVAGKATTS" misc_feature 245..760 /gene="LOC4350802" /note="Arf-like 5 (Arl5) and 8 (Arl8) GTPases; Region: Arl5_Arl8; cd04153" /db_xref="CDD:133353" ORIGIN //...
AA_position 104
XM_015759677.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group psbQ-like protein 3, chloroplastic (LOC4336434), mRNA. (915 bp)
codon_start=1 /product="psbQ-like protein 3, chloroplastic" /protein_id="XP_015636182.1" /db_xref="GeneID:4336434" /translation="MALQLAAQALSAILLSGAQPSSRRATPPGNGQRSRRPPATGRRRLAASLLASQLLLLPAAATSVAGAFEFDLRITVPEQSGEEAEAVVKLHARNLVRVKGLIDARSWRELQAALRSSAANLKQDLYAIIQASPASRRPELRRLYSDLFNSVTSLDYAARDKDELRVQEYYSNMITSLDEIFSKIM" misc_feature 209..760 /gene="LOC4336434" /note="PSII-Q subunit; Region: PLN02956" /db_xref="CDD:215515" ORIGIN //...
AA_position 161
XM_015780696.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group 60S ribosomal protein L9-like (LOC4347422), mRNA. (954 bp)
CDS 110..682 /gene="LOC4347422" /codon_start=1 /product="60S ribosomal protein L9" /protein_id="XP_015612091.1" /db_xref="GeneID:4347422" /translation="MKTILASETMEIPEGVTVQVAAKVVTVEGPRGKLTRNFKHLNLDFQLLEGGRKLQVDAWFGTRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPINASITNSNTAIEIRNFLGEKKVRKVDMLEGVTILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSDKGTITEDA" misc_feature 110..679 /gene="LOC4347422" /note="Ribosomal protein L6; Region: Ribosomal_L6; cl30086" /db_xref="CDD:392261" ORIGIN //...
AA_position 140
XM_015756605.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group 60S ribosomal protein L9-like (LOC4327999), mRNA. (949 bp)
CDS 90..668 /gene="LOC4327999" /codon_start=1 /product="60S ribosomal protein L9-like" /protein_id="XP_015625200.1" /db_xref="GeneID:4327999" /translation="MKTILASETMEIPSGVTVHVAAKVVTVEGPRGKLTRNFKHLNLDFQLLEVEGVRKLQVDAWFGTRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPINASITNSNTAIEIRNFLGEKKVRKVDMLEGVTILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSDKGTITEDQ" misc_feature 90..665 /gene="LOC4327999" /note="Ribosomal protein L6; Region: Ribosomal_L6; cl30086" /db_xref="CDD:421973" ORIGIN //...
AA_position 142
XM_015769714.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group auxin-binding protein 4 (LOC4352396), mRNA. (1778 bp)
auxin-binding protein 4" /protein_id="XP_015620272.1" /db_xref="GeneID:4352396" /translation="METRTGPTAAGGHGAHLAGAGRGALLLALVVVSAAAFLPVAESSCPRDNSLVKDVSKMYQSNYGREGFSHITIAGALAHGMKEVEVWLQTFGPGQRTPIHRHSCEEVFVVLKGKGTLLLGSSSMKYPGQPQEIPVFQNSTFSVPVNDPHQVWNSDEHEDLQVLVIISRPPVKIFTYDDWSVPHTAAKLKFPYFWDEDCLPAPKDEL" misc_feature 1041..1493 /gene="LOC4352396" /note="auxin-binding protein 1, cupin domain; Region: cupin_ABP1; cd02220" /db_xref="CDD:380349" ORIGIN //...
AA_position 203
XM_015764786.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group MADS-box transcription factor 30-like (LOC4341786), transcript variant X14, mRNA. (1253 bp)
LOC4341786" /codon_start=1 /product="MADS-box transcription factor 30 isoform X7" /protein_id="XP_025882177.1" /db_xref="GeneID:4341786" /translation="MGQGKIEMKRIEDATRRQVTFSKRRAGFLKKANELAVLCDAQVGVVVFSDKGKLFDFCSPPVILMELFHRYEITTRNTRLQETNRDDEQMVMEITRLRNEIDQLEASLRRQTGEDLSSVSTVDELSQLQLQLESSLSKVHARKDELMSQQLEDMRRMHQTVHEQNNFLCRMNVITIMILAAMISITHARIALDDCMQLGYIVIKQENSWRFWFI" misc_feature 227..439 /gene="LOC4341786" /note="MEF2 (myocyte enhancer factor 2)-like/Type II subfamily of MADS...
AA_position 143
XM_026026392.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC4339869 (LOC4339869), mRNA. (1404 bp)
by RNAseq alignments, including 107 samples with support for all annotated introns" /db_xref="GeneID:4339869" CDS 417..1064 /gene="LOC4339869" /codon_start=1 /product="uncharacterized protein LOC4339869" /protein_id="XP_015640973.1" /db_xref="GeneID:4339869" /translation="MDKAGGNQGGKVLKKGKKKHAKDELDRQKQAEKKRRRLEKALANSAAIISELEKKRQQKREEQQRLDDEGAAIAEAVALHVLIDEDSEEPCHLMLNNLRICNHWEDFVGFGFAPDSQGVDAYPSGKPTSVSHAYVPQLRWTNWGMSQTFSSWEQLTDCEAPLYQEALAQSDIHPGPIAIVSPLQKRREDPFTIQGEAVAAASSATESESGQWNQQ" ORIGIN //...
AA_position 22
XM_015785487.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group probable plastid-lipid-associated protein 11, chloroplastic (LOC4336599), transcript variant X6, mRNA. (2234 bp)
support for all annotated introns" /db_xref="GeneID:4336599" CDS 43..708 /gene="LOC4336599" /codon_start=1 /product="probable plastid-lipid-associated protein 11, chloroplastic" /protein_id="XP_015633746.1" /db_xref="GeneID:4336599" /translation="MAPLVSHAKILAPIPRGNRRLAPAPPAAGGFLRALFPSRRSRPPPEKDELLRLIADQRRGLDTQSDPSRLADIVSCIDALAAAAPGSDTVSDADKLSGTWRLLWTTEHEQLFIVRNAPFFRTAAGDVFQVIDVPGGALNNVITFPPSGAFVVNGSIEIQPPQRVNFRFTRAMLRGSNWEVPFPPFGKGWFDTVYLDDDIRVAKDIRGDYLVVERAPYSWNG" misc_feature 181..678 /gene="LOC4336599" /note="Region: PAP_fibrillin; pfam04755" /db_xref="CDD:309752" ORIGIN //...
AA_position 47
XM_015778260.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group probable plastid-lipid-associated protein 11, chloroplastic (LOC4336599), transcript variant X5, mRNA. (2231 bp)
support for all annotated introns" /db_xref="GeneID:4336599" CDS 43..708 /gene="LOC4336599" /codon_start=1 /product="probable plastid-lipid-associated protein 11, chloroplastic" /protein_id="XP_015633745.1" /db_xref="GeneID:4336599" /translation="MAPLVSHAKILAPIPRGNRRLAPAPPAAGGFLRALFPSRRSRPPPEKDELLRLIADQRRGLDTQSDPSRLADIVSCIDALAAAAPGSDTVSDADKLSGTWRLLWTTEHEQLFIVRNAPFFRTAAGDVFQVIDVPGGALNNVITFPPSGAFVVNGSIEIQPPQRVNFRFTRAMLRGSNWEVPFPPFGKGWFDTVYLDDDIRVAKDIRGDYLVVERAPYSWNG" misc_feature 181..678 /gene="LOC4336599" /note="Region: PAP_fibrillin; pfam04755" /db_xref="CDD:309752" ORIGIN //...
AA_position 47
XM_015778259.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group probable plastid-lipid-associated protein 11, chloroplastic (LOC4336599), transcript variant X4, mRNA. (2286 bp)
support for all annotated introns" /db_xref="GeneID:4336599" CDS 43..708 /gene="LOC4336599" /codon_start=1 /product="probable plastid-lipid-associated protein 11, chloroplastic" /protein_id="XP_015633744.1" /db_xref="GeneID:4336599" /translation="MAPLVSHAKILAPIPRGNRRLAPAPPAAGGFLRALFPSRRSRPPPEKDELLRLIADQRRGLDTQSDPSRLADIVSCIDALAAAAPGSDTVSDADKLSGTWRLLWTTEHEQLFIVRNAPFFRTAAGDVFQVIDVPGGALNNVITFPPSGAFVVNGSIEIQPPQRVNFRFTRAMLRGSNWEVPFPPFGKGWFDTVYLDDDIRVAKDIRGDYLVVERAPYSWNG" misc_feature 181..678 /gene="LOC4336599" /note="Region: PAP_fibrillin; pfam04755" /db_xref="CDD:309752" ORIGIN //...
AA_position 47
XM_015778258.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group probable plastid-lipid-associated protein 11, chloroplastic (LOC4336599), transcript variant X3, mRNA. (1764 bp)
support for all annotated introns" /db_xref="GeneID:4336599" CDS 43..708 /gene="LOC4336599" /codon_start=1 /product="probable plastid-lipid-associated protein 11, chloroplastic" /protein_id="XP_015633743.1" /db_xref="GeneID:4336599" /translation="MAPLVSHAKILAPIPRGNRRLAPAPPAAGGFLRALFPSRRSRPPPEKDELLRLIADQRRGLDTQSDPSRLADIVSCIDALAAAAPGSDTVSDADKLSGTWRLLWTTEHEQLFIVRNAPFFRTAAGDVFQVIDVPGGALNNVITFPPSGAFVVNGSIEIQPPQRVNFRFTRAMLRGSNWEVPFPPFGKGWFDTVYLDDDIRVAKDIRGDYLVVERAPYSWNG" misc_feature 181..678 /gene="LOC4336599" /note="Region: PAP_fibrillin; pfam04755" /db_xref="CDD:309752" ORIGIN //...
AA_position 47
XM_015778257.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group probable plastid-lipid-associated protein 11, chloroplastic (LOC4336599), transcript variant X2, mRNA. (2884 bp)
support for all annotated introns" /db_xref="GeneID:4336599" CDS 43..708 /gene="LOC4336599" /codon_start=1 /product="probable plastid-lipid-associated protein 11, chloroplastic" /protein_id="XP_025880568.1" /db_xref="GeneID:4336599" /translation="MAPLVSHAKILAPIPRGNRRLAPAPPAAGGFLRALFPSRRSRPPPEKDELLRLIADQRRGLDTQSDPSRLADIVSCIDALAAAAPGSDTVSDADKLSGTWRLLWTTEHEQLFIVRNAPFFRTAAGDVFQVIDVPGGALNNVITFPPSGAFVVNGSIEIQPPQRVNFRFTRAMLRGSNWEVPFPPFGKGWFDTVYLDDDIRVAKDIRGDYLVVERAPYSWNG" misc_feature 181..678 /gene="LOC4336599" /note="Region: PAP_fibrillin; pfam04755" /db_xref="CDD:309752" ORIGIN //...
AA_position 47
XM_026024783.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group probable plastid-lipid-associated protein 11, chloroplastic (LOC4336599), transcript variant X1, mRNA. (2371 bp)
support for all annotated introns" /db_xref="GeneID:4336599" CDS 43..708 /gene="LOC4336599" /codon_start=1 /product="probable plastid-lipid-associated protein 11, chloroplastic" /protein_id="XP_015633742.1" /db_xref="GeneID:4336599" /translation="MAPLVSHAKILAPIPRGNRRLAPAPPAAGGFLRALFPSRRSRPPPEKDELLRLIADQRRGLDTQSDPSRLADIVSCIDALAAAAPGSDTVSDADKLSGTWRLLWTTEHEQLFIVRNAPFFRTAAGDVFQVIDVPGGALNNVITFPPSGAFVVNGSIEIQPPQRVNFRFTRAMLRGSNWEVPFPPFGKGWFDTVYLDDDIRVAKDIRGDYLVVERAPYSWNG" misc_feature 181..678 /gene="LOC4336599" /note="Region: PAP_fibrillin; pfam04755" /db_xref="CDD:309752" ORIGIN //...
AA_position 47
XM_015778256.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC4328003 (LOC4328003), mRNA. (1485 bp)
by RNAseq alignments, including 112 samples with support for all annotated introns" /db_xref="GeneID:4328003" CDS 577..1248 /gene="LOC4328003" /codon_start=1 /product="uncharacterized protein LOC4328003" /protein_id="XP_015625204.1" /db_xref="GeneID:4328003" /translation="MEKAAANQAGKVLKKGKKKQAKDELDRQKQAEKKRRRLEKALANSAAIISELEKKKQKKREEQQRLDEEGAAIAEAVALHVLIGEDSDEPCHLMLNKHRRCNHWDHSAGFDFAVDAQGADIYPPDGLIQCADHVYAPKGRCIDWGIGQPLPSWGEVKDLQLQAPCYQGMFHQSVACPGFIAAQAVSSLQIGGDSSDITSPSQGATVVNRMLGATNRLNLYREI" ORIGIN //...
AA_position 22
XM_015769718.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group probable complex I intermediate-associated protein 30 (LOC4324734), transcript variant X2, mRNA. (1094 bp)
samples with support for all annotated introns" /db_xref="GeneID:4324734" CDS 95..784 /gene="LOC4324734" /codon_start=1 /product="probable complex I intermediate-associated protein 30" /protein_id="XP_015622935.1" /db_xref="GeneID:4324734" /translation="MSRLRALWQASVNATRRAIVWNSEDLIPPSEKYIFNFNSKDELKRWHLYSDSEYGGLSSASLEITDGGAGGDTSSTGLFSGNLSLDMSEGSTWKIRRSGFCGMRSKKFNGFIDLDAYDTIAMKLRGDGRCYISTIYTENWVNSPGQQEDNSWQAFVYLPQDRWQIMKIPLDSYLPTWRGNVIEAKMEMNPARVVGMSLSVNAEGGVPGAKTGPGDFRLEVDWIKALRTL" misc_feature 197..754 /gene="LOC4324734" /note="Complex I intermediate-associated protein 30 (CIA30); Region:...
AA_position 40
XM_015767449.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group probable complex I intermediate-associated protein 30 (LOC4324734), transcript variant X1, mRNA. (1132 bp)
samples with support for all annotated introns" /db_xref="GeneID:4324734" CDS 133..822 /gene="LOC4324734" /codon_start=1 /product="probable complex I intermediate-associated protein 30" /protein_id="XP_015622930.1" /db_xref="GeneID:4324734" /translation="MSRLRALWQASVNATRRAIVWNSEDLIPPSEKYIFNFNSKDELKRWHLYSDSEYGGLSSASLEITDGGAGGDTSSTGLFSGNLSLDMSEGSTWKIRRSGFCGMRSKKFNGFIDLDAYDTIAMKLRGDGRCYISTIYTENWVNSPGQQEDNSWQAFVYLPQDRWQIMKIPLDSYLPTWRGNVIEAKMEMNPARVVGMSLSVNAEGGVPGAKTGPGDFRLEVDWIKALRTL" misc_feature 235..792 /gene="LOC4324734" /note="Complex I intermediate-associated protein 30 (CIA30); Region:...
AA_position 40
XM_015767444.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group disease resistance protein Pik-2-like (LOC107278598), mRNA. (699 bp)
Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:107278598" CDS 1..699 /gene="LOC107278598" /codon_start=1 /product="disease resistance protein Pik-2-like" /protein_id="XP_025879696.1" /db_xref="GeneID:107278598" /translation="MESVVVTAAEGAVKTLLGKLGSFLSQEPRLLGGVRGELQYIKDELESMNAFLQNLAATSSHSVQVKIWMKQVREMAYDAEDCIDEFQHHFGGYCGNGIVGFIYRMKHLMYTLKVRHRIVMQVQELKVRARDVSDRQVIGFIQDDLLVGINNRRDRVLTYLRVDSDQELRVISIFGFGGLGKTTLAKAIYDSPQLIPPASDQHVSSDIEDEHLKAIEKLAPSDFPNDLTIIRY" misc_feature 25..402 /gene="LOC107278598" /note="Coiled-coil domain of the potato virux X resistance protein and...
AA_position 42
XM_026023911.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC4341082 (LOC4341082), transcript variant X2, mRNA. (1578 bp)
including 25 samples with support for all annotated introns" /db_xref="GeneID:4341082" CDS 392..1096 /gene="LOC4341082" /codon_start=1 /product="uncharacterized protein LOC4341082 isoform X2" /protein_id="XP_015641873.1" /db_xref="GeneID:4341082" /translation="MEISGPGGGSNHTHLTERGEILEDAHDKKDELRAEDLELKLNEPFLNFMRLRLIPQWGQGFTSECQLKTAQDQLEWHSQIKPTRLPVLALHIGNKKFARTNECDIFVKFFYHKKSVIFQMSKDKLCRKVDIPFDDITSFCFVFGQQSDILTIEVKSSLIPLSAAKPLPGKFLDWKVDYSKDDEYYFPESKSLWVEAEKGSLEKTYAKLKYTNPHLTCLFTDAGEQGETSARHAT" ORIGIN //...
AA_position 29
XM_015786387.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group 39S ribosomal protein L46, mitochondrial (LOC4340823), mRNA. (1153 bp)
protein_id="XP_015641545.1" /db_xref="GeneID:4340823" /translation="MLLRSPARSSPHLRSLLRARGFISSASPSAATAAEGDDGKIVASVLFERLPVVIPKIHPVVYAFQEFSFRWRQQYRRKYPDDVLGKADARGKGDYQIDYVPAPRITDADKTNDRKSLQRALDNRLYLLLYGKAYGAPDDKPVWHFPEKVYDNEDTLRLCAESALKSVLGGLNNTYFVGNAPMAHMVVDQKEDSSISSFKRFFFKSQVVGATKYDIGKCQDHVWVTKDELLEYFPEHKAFFNKMIIHIR" misc_feature 197..406 /gene="LOC4340823" /note="39S mitochondrial ribosomal protein L46; Region: MRP-L46; pfam11788" /db_xref="CDD:288621" misc_feature 413..787 /gene="LOC4340823" /note="Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it...
AA_position 226
XM_015786059.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group probable calcium-binding protein CML48 (LOC4346304), mRNA. (1296 bp)
codon_start=1 /product="probable calcium-binding protein CML48" /protein_id="XP_015650482.1" /db_xref="GeneID:4346304" /translation="MADYNRYGYGGYGSTPSAPPASSYGYTTTPSAPPAYGYGHGGGGYPSSTYSSSQAYPMGMGGFLVFPPGTHPDVERAFRAVDRDGSGSIDERELQDALSSAYHRFSIRTVRLLLFLFNKPASHSPSRMGPAEFVSLWNCLGQWRGIFDRYDRDGSGKIEKDELREALRSLGYAVPPSVLELLIANYNNGVSSRGALDFDNFVECGMIVKGLTEKFKEKDTRYSGSATLSYDGFLSMVIPFIVP" misc_feature 480..983 /gene="LOC4346304" /note="Penta-EF hand, calcium binding motifs, found in Group I PEF proteins; Region: EFh_PEF_Group_I; cd16180" /db_xref="CDD:320055" ORIGIN //...
AA_position 170
XM_015794996.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group transcription factor ILR3 (LOC4344627), mRNA. (1184 bp)
gene="LOC4344627" /codon_start=1 /product="transcription factor ILR3" /protein_id="XP_015649810.1" /db_xref="GeneID:4344627" /translation="MSGTPADSGDDWFLDCGILEDLPAAACGAFPWDASPSCSNPSVEVSSYVNTTSYVLKEPGSNKRVRSGSCGRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMVIQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVKILTATPAYMPHPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDSEACPPVA" misc_feature 391..618 /gene="LOC4344627" /note="basic helix-loop-helix (bHLH) domain found in Arabidopsis thaliana protein IAA-leucine resistant 3 (ILR3) and similar proteins; Region: bHLH_AtILR3_like; cd11446" /db_...
AA_position 158
XM_015794324.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC107280888 (LOC107280888), mRNA. (938 bp)
all annotated introns" /db_xref="GeneID:107280888" CDS 26..796 /gene="LOC107280888" /codon_start=1 /product="uncharacterized protein LOC107280888" /protein_id="XP_015638391.1" /db_xref="GeneID:107280888" /translation="MNRAERQPITWEEFTEGFKKTHVPVGVVALKKREFRALKQKDRTVAEYLHEFNRLARYAPEDVRTDEERQEKFLEGPKDELSVMLISHDYEDFQELVDKAIRLEDKKNKMDNRKRKMTVSQEAQGSSQRQRIKPLQIGESFSAGQEQSQQQSQQLGISGEINSETNASNEDNDEQATQSVSFQQDQSQEDNSNGREHRVCFNCYEPGHFVKECPKPKRQQPQGQVNNIVLTGANAVPVASQGIQLSHQFQSSSSFL" misc_feature <32..253 /gene="LOC107280888" /note="Retrotransposon gag protein; Region: Retrotrans_gag; pfam03732" /db_xref="...
AA_position 78
XM_015782905.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group F-box protein At4g35930 (LOC4348714), transcript variant X2, mRNA. (1425 bp)
samples with support for all annotated introns" /db_xref="GeneID:4348714" CDS 375..1160 /gene="LOC4348714" /codon_start=1 /product="F-box protein At4g35930 isoform X2" /protein_id="XP_015613407.1" /db_xref="GeneID:4348714" /translation="MGTGSVTVKQKKRVKHTKNKYLKPGALAQIRYSRSTSRDIGKKRILLNVDKDELPQEEVAFENTEPMMSPKRLNFEPFSGTKGQVMPITPKTPQSDELSDGHSRLESLPLELLIKIICCLHHDQLNIVFHVSKRIRKAVELARQYHFNYTTPDRSRQELLQHTTPLPTEHWPFMRIDGKDVRISTPRTPKAPKHAPRLARLELLDFKPITAVLFPDTFPSKRLRRSMPPGLPRPVSKAASSTRVLLYEEELCEAVAQNKLL" ORIGIN //...
AA_position 51
XM_015757921.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group F-box protein At4g35930 (LOC4348714), transcript variant X1, mRNA. (1432 bp)
samples with support for all annotated introns" /db_xref="GeneID:4348714" CDS 379..1167 /gene="LOC4348714" /codon_start=1 /product="F-box protein At4g35930 isoform X1" /protein_id="XP_015613406.1" /db_xref="GeneID:4348714" /translation="MGTGSVTVKQKKRVKHTKNKYLKPGALAQIRYSRSTSRDIGKKRILLNVDKDELPQEEVAFENTEPMMSPKRLNFEPFSGTKGQVMPITPKTPQSDELSDGHSRLESLPLELLIKIICCLHHDQLNIVFHVSKRIRKAVELARQYHFNYTTPDRSRQELLQHTTPLPTEHWPFMSRIDGKDVRISTPRTPKAPKHAPRLARLELLDFKPITAVLFPDTFPSKRLRRSMPPGLPRPVSKAASSTRVLLYEEELCEAVAQNKLL" ORIGIN //...
AA_position 51
XM_015757920.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group uncharacterized LOC4350522 (LOC4350522), mRNA. (1174 bp)
db_xref="GeneID:4350522" /translation="MSFFGIHGVSGEEEEKVVGVEQQGFRVRATKLIRWPKLGNIWGWIFYRRKETPTLEGTNREKKTEENQRSGARKGKERRCLSMAAEGSSRRKASWLGMSSEGGAAKFLSGLPSRGNFSSISASSTLGRLRVYVCEHDTDPPEGQVIETDTTNILIRHLQLKKKEMDAKEAKEARDAGSRNQGETVKWKRVAPRSLDGQSSSKRPNLGSSSGLSSAEEAAPGFSGHTLQTFTVERLRALLRQRGLMTKGKKDELIARLRESQD" misc_feature 346..522 /gene="LOC4350522" /note="Det1 complexing ubiquitin ligase; Region: DDA1; pfam10172" /db_xref="CDD:401980" misc_feature 709..807 /gene="LOC4350522" /note="SAP domain; Region: SAP; pfam02037" /db_xref="CDD:396567" ORIGIN //...
AA_position 255
XM_015759724.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group peroxygenase-like (LOC4332103), mRNA. (1096 bp)
product="peroxygenase-like" /protein_id="XP_015629052.1" /db_xref="GeneID:4332103" /translation="MATLLLIACLPTRRPHLSLRQRSYKLAPRITMAPPSSDPSLETVAPHAAVTGERKLNPNLQEQLPKPYLARALAAVDPSHPQGTRGRDARGMSVLQQHAAFFDRNGDGIIYPWETFQGLRAIGCGYPVSIAGAILINLVLSYPTQPGWMPSPLFSIHIKNIHKGKHGSDSEAYDTEGRFDPSKFDAIFSKYGRTHPNALTKDELNSMIKANRNMYDFIGWITSAGEWMLLYSVAKDKEGLLQRETVRGAFDGSLFERLQDSKKSA" misc_feature 383..892 /gene="LOC4332103" /note="Caleosin related protein; Region: Caleosin; pfam05042" /db_xref="CDD:398633" ORIGIN //...
AA_position 207
XM_015773566.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group apoptotic chromatin condensation inducer in the nucleus (LOC4332988), transcript variant X2, mRNA. (2923 bp)
including 92 samples with support for all annotated introns" /db_xref="GeneID:4332988" CDS 420..2567 /gene="LOC4332988" /codon_start=1 /product="apoptotic chromatin condensation inducer in the nucleus" /protein_id="XP_015631515.1" /db_xref="GeneID:4332988" /translation="MSSYPVLNNRPIDQWRVTDLKDELRKRRLPVKGLKDELVRRLFESIQSEKEEEEEEQDNETVEVNPAANQASEIQSVSQETTVSITEVHKETVVQVTQEATPPITEVSQSLTVSAAEEPPKVNAVATHEAPLSKAPTDKGEEPPIAGDVSTVENEHLHAENNTEPFVEKTQDVGTNEAIGALDMTSADVESDMTSSDIKIDATEASKVQQHDTVATTVDAIPTDADPMDTDVATEKAVLNDLGDTTSVYDEERKDSELTNEDEKPIAPKPNDQVPEVSPDLGSPIKCESISSDDISTNKKNNIKDNLNANNFDLELEAKPEMVKPSSGI...
AA_position 21
XM_015776029.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group apoptotic chromatin condensation inducer in the nucleus (LOC4332988), transcript variant X1, mRNA. (2998 bp)
including 97 samples with support for all annotated introns" /db_xref="GeneID:4332988" CDS 420..2567 /gene="LOC4332988" /codon_start=1 /product="apoptotic chromatin condensation inducer in the nucleus" /protein_id="XP_015631513.1" /db_xref="GeneID:4332988" /translation="MSSYPVLNNRPIDQWRVTDLKDELRKRRLPVKGLKDELVRRLFESIQSEKEEEEEEQDNETVEVNPAANQASEIQSVSQETTVSITEVHKETVVQVTQEATPPITEVSQSLTVSAAEEPPKVNAVATHEAPLSKAPTDKGEEPPIAGDVSTVENEHLHAENNTEPFVEKTQDVGTNEAIGALDMTSADVESDMTSSDIKIDATEASKVQQHDTVATTVDAIPTDADPMDTDVATEKAVLNDLGDTTSVYDEERKDSELTNEDEKPIAPKPNDQVPEVSPDLGSPIKCESISSDDISTNKKNNIKDNLNANNFDLELEAKPEMVKPSSGI...
AA_position 21
XM_015776027.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group E3 ubiquitin-protein ligase CHIP (LOC4344499), mRNA. (1265 bp)
introns" /db_xref="GeneID:4344499" CDS 176..997 /gene="LOC4344499" /codon_start=1 /product="E3 ubiquitin-protein ligase CHIP" /protein_id="XP_015648635.1" /db_xref="GeneID:4344499" /translation="MSPAADSAASKRQAELLKQEGNAFFKKDRISAAIDAYTGAIALCPKVAVYWTNRALCYKRRNEWVRAEEDCRTAIQLDSHSVKAHYMLGLALLNKDELAEGIKELEKSLELGRGAHPASYMVEEIWQELSKAKYIEWENLSSERVRQLHKLKEACKEALRNYNSLDNPPAYVPEEQLNELEEVFRNARKSDIPTEVPDHLCCKITLDIFRDPVITPSGITYERAVILDHLHRVGKFDPVTRETLEPHQLVPNLAIKEAVHAFLSEHGWAYRMR" misc_feature 206..>427 /gene="LOC4344499" /note="mitochondrial precursor proteins import receptor...
AA_position 95
XM_015793149.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group probable mediator of RNA polymerase II transcription subunit 26c (LOC112939375), mRNA. (1063 bp)
LOC112939375" /codon_start=1 /product="probable mediator of RNA polymerase II transcription subunit 26c" /protein_id="XP_025882241.1" /db_xref="GeneID:112939375" /translation="MAEQGILRRWKRFFPAFASIHAAIEAAEPGISRKEFRDATDKVVAMLCSATDDEAVAEELRVVLDEMMVEALLTLELVPAMPKMLASTDLAQDVGALRNHPSERVRGLATGIVRAWRASVKDELLKAAAAMEKLSQALEPDEADDHHAKILQPSPPKKTANSSQPSFPKKQSAPVAGGSHVTMAKMEPPREKLPAAVGSFRRESAASCGTDEKAMNAAKRKLREGYQEAEDAKRQRTIKVIEAPKQQQRKRHPIVQERNRSRVASHTSSLRRRF" misc_feature 192..>776 /gene="LOC112939375" /note="transcription elongation factor S-II; Region: TFSII; TIGR01385" /db_xref="CDD:273592" misc_...
AA_position 121
XM_026026456.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group dehydration-responsive element-binding protein 2A-like (LOC4324418), mRNA. (1472 bp)
product="dehydration-responsive element-binding protein 2A" /protein_id="XP_025878770.1" /db_xref="GeneID:4324418" /translation="MERGEGRRGDCSVQVRKKRTRRKSDGPDSIAETIKWWKEQNQKLQEENSSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPNRGRRLWLGSFPTALEAAHAYDEAARAMYGPTARVNFADNSTDANSGCTSAPSLMMSNGPATIPSDEKDELESPPFIVANGPAVLYQPDKKDVLERVVPEVQDVKTEGSNGLKRVCQERKNMEVCESEGIVLHKEVNISYDYFNVHEVVEMIIVELSADQKTEVHEEYQEGDDGFSLFSY" misc_feature 642..809 /gene="LOC4324418" /note="DNA-binding domain in plant proteins such as APETALA2 and EREBPs; Region: AP2; smart00380" /db_xref="CDD:197689" misc_feature order...
AA_position 162
XM_026022985.1 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Oryza sativa Japonica Group ribonuclease 2 (LOC4325103), mRNA. (1338 bp)
CDS 85..939 /gene="LOC4325103" /codon_start=1 /product="ribonuclease 2" /protein_id="XP_015650189.1" /db_xref="GeneID:4325103" /translation="MATARKAPRMVAIWAAADLFGAAVARSASARHAVGKKQREFDYFALALQWPGTICASTRHCCAINGCCRSEPLQTFTIHGLWPDYDDGTWPACCRHTSFDMDKILPLKPTLEKYWPSLYCSSSSTCFSGKGPFWAHEWEKHGTCSSPVVKDELEYFTTALDLYFKYNVTEMLASGGIHVSNGKQYALTDVIDAIKCAFGASPQIVCKKGSVEELRLCFDKDLKPLDCLTTTATNENVSKKKYCPRYITLPTYDPIVHANSTREIITVESEVYGYLYTS" misc_feature 223..783 /gene="LOC4325103" /note="Ribonuclease T2 family; Region: Ribonuclease_T2; pfam00445" /db_xref="CDD:395357" ORIGIN //...
AA_position 156
XM_015794703.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/os/aa%3aKDEL
lang : en | div : | spe : os | query_string : aa:KDEL | format : html | download :

0.000 | 0.000 | search_start;
16.218 | 16.218 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=(aa:KDEL)?source=Oryza sativa Japonica Group (Japanese rice)?to=0&format=json
16.441 | 0.223 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=(aa:KDEL)?source=Oryza sativa Japonica Group (Japanese rice)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
16.446 | 0.005 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]