ver.2
Help
|
Advanced search
|
English
旧バージョン
2026-04-24 18:02:24, GGRNA : RefSeq release 233 (Jan, 2026)
Summary:
Results:
検索語に色がつきます。重なると色が濃く表示されます。
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..734 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 735..2143 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2143) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain...
exon 176..485 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..2005 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2005) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain containing 1 contributing to endothelial cell adhesion...
Gm16492; Gm513" /note="claudin 21, pseudogene; claudin 25, pseudogene" /codon_start=1 /product="putative claudin-25" /protein_id="NP_001371194.1" /db_xref="GeneID:100042785" /db_xref="MGI:MGI:3642767" /translation="MACSFRGRVQLGGLLLSVLGWVCSCVTTVLPQWKTLTLDLNEMETWVSGLWEACVNQEEAGTVCKAFESFLSLPQELQVARILMVASHGLGLLGLLLSSCGLECFRFHRPGGVFKTRLCLLGGTLEASASATTLFPVSWVAYATFQDFWDDSIPEIVPRWEFGDALFLGWAAGLFLAVGGLLLIFSACLENEDGSSSWMADATAPQACAPVEEEFDGSFHLTPRPVNQVI" misc_feature 124..597 /gene="Cldn25" /gene_synonym="Cldn21; Cldn21-ps; Cldn25-ps; Gm16492; Gm513" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: Cldn21; Cldn21-ps; Cldn25-ps; Gm16492; Gm513
NM_001384265.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CH466554.1. On Dec 14, 2007 this sequence version replaced XM_001473536.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CH466633.1. On or before Oct 13, 2007 this sequence version replaced XM_904536.1, XM_888581.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
culus claudin 2 (Cldn2), transcript variant 1, mRNA. ACCESSION NM_016675 VERSION NM_016675.5 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced NM_016675.4. Summary: This gene encodes a member of the claudin family. Claudins are...
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced XM_006528490.4. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160099.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160098.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160097.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160096.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_023878.3 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /codon_start=1 /product="claudin domain-containing protein 1 isoform X1" /protein_id="XP_011244188.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <627..809 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
gene_synonym="EG625591; Gm6604" /codon_start=1 /product="claudin 34C2" /protein_id="NP_001365203.1" /db_xref="GeneID:625591" /db_xref="MGI:MGI:3644765" /translation="MVLLNKSANHQIRGFTLATIACIMCNTSMALPEWRICYLNNSMLSYPSLAFVNIWEAYICHHNHNSSHLRDCHYYTCHNNLVPLDIRVSQILLLVANVVGLVGTVCSVFALQQLYTEELHKNNDYNPFVLSAVLNAIASTFIFLAVMCNHLSVPSKEEVSFLQSFQMPIFSNAQRAGRAMGLAYISAILFLLSAIIFISYCPSMEIKMFPRV" ORIGIN // REFERENCE 1 (bases 1 to 857) AUTHORS Seker M, Fernandez-Rodriguez C, Martinez-Cruz LA and Muller D. TITLE Mouse Models of Human Claudin-Associated Disorders: Benefits and Limitations JOURNAL Int J Mol Sci...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_021386.3. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_021386.4 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK002672.1 and AV041302.2. On Aug 4, 2010 this sequence version replaced NM_009902.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
LOCUS NM_001101585 639 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus claudin 34, pseudogene (Cldn34-ps), mRNA. ACCESSION NM_001101585 XM_893693 XM_910639 VERSION NM_001101585.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT PREDICTED REFSEQ: This record has not been reviewed and the function is unknown. The reference sequence was derived from CH466576.2. On or before...
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK036780.1 and CK626537.1. On Aug 3, 2010 this sequence version replaced NM_016674.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145152.1, BC132378.1 and BQ031935.1. On Nov 15, 2007 this sequence version replaced NM_009903.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
LOCUS NM_001097980 1081 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus claudin 34B1 (Cldn34b1), mRNA. ACCESSION NM_001097980 XM_001475498 VERSION NM_001097980.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata;...COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 214..750 /gene="Cldn34b1" /gene_synonym="EG546400; Gm16390" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN // REFERENCE 1 (bases 1 to 1081) AUTHORS Gaudet P, Livstone MS, Lewis SE and...
LOCUS NM_001201395 1003 bp mRNA linear ROD 07-AUG-2023 DEFINITION Mus musculus claudin 34D (Cldn34d), mRNA. ACCESSION NM_001201395 XM_135954 VERSION NM_001201395.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata;...misc_feature 217..759 /gene="Cldn34d" /gene_synonym="4930468A15Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN // REFERENCE 1 (bases 1 to 1003) AUTHORS Gaudet P, Livstone MS, Lewis SE and Thomas PD. TITLE Phylogenetic-based propagation of...
LOCUS NM_001310652 3160 bp mRNA linear ROD 05-AUG-2023 DEFINITION Mus musculus claudin 34C1 (Cldn34c1), transcript variant 2, mRNA. ACCESSION NM_001310652 XM_006528408 VERSION NM_001310652.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK032219.1, BX521033.1 and...
LOCUS NM_028426 3317 bp mRNA linear ROD 05-AUG-2023 DEFINITION Mus musculus claudin 34C1 (Cldn34c1), transcript variant 1, mRNA. ACCESSION NM_028426 XM_888743 XM_912053 VERSION NM_028426.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK032219.1, BC027572.1 and...
LOCUS NM_001310654 3276 bp mRNA linear ROD 05-AUG-2023 DEFINITION Mus musculus claudin 34C1 (Cldn34c1), transcript variant 3, mRNA. ACCESSION NM_001310654 XM_006528409 VERSION NM_001310654.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK032219.1 and...
gene="Cldn34b4" /gene_synonym="4930428D18Rik" /codon_start=1 /product="claudin 34B4" /protein_id="NP_001343325.1" /db_xref="CCDS:CCDS53116.1" /db_xref="GeneID:619294" /db_xref="MGI:MGI:3588232" /translation="MLIKNRCNSQMGGFALTTVAWLICCISIGLPQWRVWHFQDPVVFKSTTAFVGMWRVCTLQYDEDFRNMRICHQYNYHDTFLPLNIRMIQQLLLVSSFFGLVGKVTTIIALWNVCQGRVHRKATYNPFGLSGILNIISSSFICLAILINYVSIIFQEGIIFPPSFNIPSQPDTQEIGSAMALAFIAAVLFLLSGTILLTSNFPVDKPVCSKY" misc_feature 289..828 /gene="Cldn34b4" /gene_synonym="4930428D18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
gene="Cldn34b4" /gene_synonym="4930428D18Rik" /codon_start=1 /product="claudin 34B4" /protein_id="NP_001028971.1" /db_xref="CCDS:CCDS53116.1" /db_xref="GeneID:619294" /db_xref="MGI:MGI:3588232" /translation="MLIKNRCNSQMGGFALTTVAWLICCISIGLPQWRVWHFQDPVVFKSTTAFVGMWRVCTLQYDEDFRNMRICHQYNYHDTFLPLNIRMIQQLLLVSSFFGLVGKVTTIIALWNVCQGRVHRKATYNPFGLSGILNIISSSFICLAILINYVSIIFQEGIIFPPSFNIPSQPDTQEIGSAMALAFIAAVLFLLSGTILLTSNFPVDKPVCSKY" misc_feature 317..856 /gene="Cldn34b4" /gene_synonym="4930428D18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" regulatory...
uct="claudin 34B3 precursor" /protein_id="NP_001013782.1" /db_xref="CCDS:CCDS53115.1" /db_xref="GeneID:238829" /db_xref="MGI:MGI:3648293" /translation="MPLKKCHRQMGGFALTTVAWLLCCISTGLPQWQVWHYEDPVILKPTVALVGMWRACIFHTDSNSSNTRVCYQYKYDGSIHLYIQVNQHLLLVSSFLGLFGKITTIIALSNVHMGRVRRNATCNPFRLSGILNIIASSFLYLAVLFNYIAIMSKWGIAFPPSFNLPFQPDIRKMGSATALAIIAAVFFLLSGTICLSSNLAIGKVPHSKM" sig_peptide 165..254 /gene="Cldn34b3" /gene_synonym="EG238829; Gm4937" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 216..752 /gene="Cldn34b3" /gene_synonym="EG238829; Gm4937" /note="PMP-22/EMP/MP20/Claudin...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB872815.1, BC083341.1 and BE627334.1. On Aug 5, 2010 this sequence version replaced NM_013805.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
misc_feature 257..319 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 293..946 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 368..370 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
misc_feature 272..334 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 308..961 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 383..385 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 2" /protein_id="NP_001239379.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature 286..939 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region...
variant 3; claudin domain-containing protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 3" /protein_id="NP_001239380.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <616..798 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
db_xref="MGI:MGI:1860425" CDS 432..1151 /gene="Cldn14" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_036015927.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 498..974 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
db_xref="MGI:MGI:1276110" CDS 199..963 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528551.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 211..741 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
db_xref="MGI:MGI:1276110" CDS 361..1125 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528552.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 373..903 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
db_xref="MGI:MGI:1276110" CDS 388..1152 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528550.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 400..930 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
db_xref="MGI:MGI:1276110" CDS 402..1166 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528549.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 414..944 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
CDS 157..702 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X3" /protein_id="XP_030098889.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLLLSACRHDLAEHRSHQRIPVVRRLIGRCCGAQAQRQIRGGVCDYLD" misc_feature 223..576 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
db_xref="MGI:MGI:1860425" CDS 229..948 /gene="Cldn14" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_006523130.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 295..771 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
CDS 155..661 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X4" /protein_id="XP_030098890.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGFCFLLADMILQSTEAISGFPLCDG" misc_feature 221..586 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
CDS 261..764 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X5" /protein_id="XP_030098891.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGFCFLLADMILQSTEAISGFPVCL" misc_feature 327..692 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
CDS 120..749 /gene="Cldn34b2" /gene_synonym="1700042B14Rik" /codon_start=1 /product="claudin 34B2 isoform X1" /protein_id="XP_011246174.1" /db_xref="GeneID:73347" /db_xref="MGI:MGI:1920597" /translation="MPLKKCHGQMGGFALTTVAWLLCCISTGLPQWQVWHYEDPVVLKPTVALVGMWRACVFHTDRNSSNTRVCYQYNYDGSIPLYIRGNQHLLLVSSFLGLFGKITTIIALSNVHMGRVRRNATCNPFRLSGILNIIASSFLYLAVLFNYIAIMSKWGIAFPPSFNLPFQPDTRKMGSAMALAIIAAVFFLLSGTICLSSNLNIDKTPRSKM" misc_feature 171..707 /gene="Cldn34b2" /gene_synonym="1700042B14Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
gene="Cldn34b4" /gene_synonym="4930428D18Rik" /codon_start=1 /product="claudin 34B4 isoform X1" /protein_id="XP_006528276.1" /db_xref="GeneID:619294" /db_xref="MGI:MGI:3588232" /translation="MLIKNRCNSQMGGFALTTVAWLICCISIGLPQWRVWHFQDPVVFKSTTAFVGMWRVCTLQYDEDFRNMRICHQYNYHDTFLPLNIRMIQQLLLVSSFFGLVGKVTTIIALWNVCQGRVHRKATYNPFGLSGILNIISSSFICLAILINYVSIIFQEGIIFPPSFNIPSQPDTQEIGSAMALAFIAAVLFLLSGTILLTSNFPVDKPVCSKY" misc_feature 343..882 /gene="Cldn34b4" /gene_synonym="4930428D18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X1" /protein_id="XP_017167838.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLLLSACRHDLAEHRSHQRIPGMPMNAACLGQNKGMAFSLAPACFSAERRDRSLETTETRIKWLVES" misc_feature 224..577 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X2" /protein_id="XP_030098888.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGNQHEGKRVETTPLEDSPPQKLPSHLFFLAKSTITSSDFPAPALQDTRWKRPWNPHP" misc_feature 242..607 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins...
LOCUS XM_006528662 1107 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus claudin 34B1 (Cldn34b1), transcript variant X1, mRNA. ACCESSION XM_006528662 VERSION XM_006528662.4 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota...misc_feature 239..775 /gene="Cldn34b1" /gene_synonym="EG546400; Gm16390" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
LOCUS XM_011247720 493 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus claudin 34C2 (Cldn34c2), transcript variant X3, mRNA. ACCESSION XM_011247720 VERSION XM_011247720.3 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
LOCUS XM_011240674 3597 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus claudin 12 (Cldn12), transcript variant X4, mRNA. ACCESSION XM_011240674 VERSION XM_011240674.1 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Data Export:
下記より最大10000件まで検索結果を取得できます。
Debug Info:
Redirect URI : https://ggrna.dbcls.jp/ja/mm/claudin
lang : ja |
div : |
spe : mm |
query_string : claudin |
format : html |
download :
0.000 | 0.000 | search_start;
0.098 | 0.098 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Mus musculus (house mouse)?to=0&format=json
0.161 | 0.064 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Mus musculus (house mouse)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.167 | 0.006 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]