GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-21 16:37:58, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001101560             660 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus claudin 20 (Cldn20), mRNA.
ACCESSION   NM_001101560 XM_888581 XM_904536
VERSION     NM_001101560.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 660)
  AUTHORS   Higashi AY, Higashi T, Furuse K, Ozeki K, Furuse M and Chiba H.
  TITLE     Claudin-9 constitutes tight junctions of folliculo-stellate cells
            in the anterior pituitary gland
  JOURNAL   Sci Rep 11 (1), 21642 (2021)
   PUBMED   34737342
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 660)
  AUTHORS   Westmoreland JJ, Drosos Y, Kelly J, Ye J, Means AL, Washington MK
            and Sosa-Pineda B.
  TITLE     Dynamic distribution of claudin proteins in pancreatic epithelia
            undergoing morphogenesis or neoplastic transformation
  JOURNAL   Dev Dyn 241 (3), 583-594 (2012)
   PUBMED   22275141
REFERENCE   3  (bases 1 to 660)
  AUTHORS   Lal-Nag M and Morin PJ.
  TITLE     The claudins
  JOURNAL   Genome Biol 10 (8), 235 (2009)
   PUBMED   19706201
  REMARK    Review article
REFERENCE   4  (bases 1 to 660)
  AUTHORS   Angelow S, Ahlstrom R and Yu AS.
  TITLE     Biology of claudins
  JOURNAL   Am J Physiol Renal Physiol 295 (4), F867-F876 (2008)
   PUBMED   18480174
  REMARK    Review article
REFERENCE   5  (bases 1 to 660)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim Biophys Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   6  (bases 1 to 660)
  AUTHORS   Rizzolo LJ, Chen X, Weitzman M, Sun R and Zhang H.
  TITLE     Analysis of the RPE transcriptome reveals dynamic changes during
            the development of the outer blood-retinal barrier
  JOURNAL   Mol Vis 13, 1259-1273 (2007)
   PUBMED   17679949
  REMARK    Publication Status: Online-Only
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CH466633.1.
            
            On or before Oct 13, 2007 this sequence version replaced
            XM_904536.1, XM_888581.1.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The protein encoded by this gene is
            identified in retinal pigment epithelium (RPE) and analysis of the
            RPE transcriptome reveals that this gene expression appears late
            during development of chick embryo. [provided by RefSeq, Aug 2010].
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..660
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="mixed"
                     /db_xref="taxon:10090"
                     /chromosome="17"
                     /map="17 2.01 cM"
     gene            1..660
                     /gene="Cldn20"
                     /gene_synonym="EG621628"
                     /note="claudin 20"
                     /db_xref="GeneID:621628"
                     /db_xref="MGI:MGI:3646757"
     CDS             1..660
                     /gene="Cldn20"
                     /gene_synonym="EG621628"
                     /codon_start=1
                     /product="claudin-20 precursor"
                     /protein_id="NP_001095030.1"
                     /db_xref="CCDS:CCDS49928.1"
                     /db_xref="GeneID:621628"
                     /db_xref="MGI:MGI:3646757"
                     /translation="
MASAGLQLLAFILAVSGVSGVLAATLLPNWKVNAYAGPNIVTAVVQVQGLWVDCTWYSTGMFSCTLKYSILSLPVHVQTARATMVLACVLSAWGICTSIAGMNCTHLGGDTHTKSKISFAGGVCFITAGISGLIPTVWYTKEIIANFLDLTIPESHKYEPGGALYIGFISAMLLLISGVIFCTSYIQKNQEPWIYPPKQKLSTTWQPKNRRAHNLKDYM"
     sig_peptide     1..69
                     /gene="Cldn20"
                     /gene_synonym="EG621628"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    13..543
                     /gene="Cldn20"
                     /gene_synonym="EG621628"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     exon            1..660
                     /gene="Cldn20"
                     /gene_synonym="EG621628"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atggcctcggcaggtctccagctccttgctttcatcctggccgtgtctggggtgtctggagtactcgctgccactctgctgccaaactggaaggttaatgcatacgcaggacccaacattgtaactgctgttgtccaggtgcaggggttgtgggtggactgcacgtggtacagcactgggatgtttagctgcactctaaaatactccattctgtcgctccccgtccatgtgcagactgcgagggccaccatggtcctggcctgtgttctgtctgcttgggggatttgtacttcgatagcaggaatgaactgcactcacttaggaggagacacacacaccaagagtaaaatttcctttgctggaggagtctgcttcatcactgcagggatctctggtttaatcccaacagtgtggtacaccaaggagatcatagcgaactttctggatctgaccattccggaaagccacaaatatgaacctggaggagccctgtacattgggtttatttcggcgatgctactacttatctctggtgttattttctgcacttcttatatacagaagaaccaagaaccatggatctaccctcccaagcagaaactttccactacctggcagccaaagaacaggcgagcacataacttgaaggattacatgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]