ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-24 11:49:30, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001101560 660 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus claudin 20 (Cldn20), mRNA. ACCESSION NM_001101560 XM_888581 XM_904536 VERSION NM_001101560.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 660) AUTHORS Higashi AY, Higashi T, Furuse K, Ozeki K, Furuse M and Chiba H. TITLE Claudin-9 constitutes tight junctions of folliculo-stellate cells in the anterior pituitary gland JOURNAL Sci Rep 11 (1), 21642 (2021) PUBMED 34737342 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 660) AUTHORS Westmoreland JJ, Drosos Y, Kelly J, Ye J, Means AL, Washington MK and Sosa-Pineda B. TITLE Dynamic distribution of claudin proteins in pancreatic epithelia undergoing morphogenesis or neoplastic transformation JOURNAL Dev Dyn 241 (3), 583-594 (2012) PUBMED 22275141 REFERENCE 3 (bases 1 to 660) AUTHORS Lal-Nag M and Morin PJ. TITLE The claudins JOURNAL Genome Biol 10 (8), 235 (2009) PUBMED 19706201 REMARK Review article REFERENCE 4 (bases 1 to 660) AUTHORS Angelow S, Ahlstrom R and Yu AS. TITLE Biology of claudins JOURNAL Am J Physiol Renal Physiol 295 (4), F867-F876 (2008) PUBMED 18480174 REMARK Review article REFERENCE 5 (bases 1 to 660) AUTHORS Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig IE. TITLE Structure and function of claudins JOURNAL Biochim Biophys Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 6 (bases 1 to 660) AUTHORS Rizzolo LJ, Chen X, Weitzman M, Sun R and Zhang H. TITLE Analysis of the RPE transcriptome reveals dynamic changes during the development of the outer blood-retinal barrier JOURNAL Mol Vis 13, 1259-1273 (2007) PUBMED 17679949 REMARK Publication Status: Online-Only COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CH466633.1. On or before Oct 13, 2007 this sequence version replaced XM_904536.1, XM_888581.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is identified in retinal pigment epithelium (RPE) and analysis of the RPE transcriptome reveals that this gene expression appears late during development of chick embryo. [provided by RefSeq, Aug 2010]. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..660 /organism="Mus musculus" /mol_type="mRNA" /strain="mixed" /db_xref="taxon:10090" /chromosome="17" /map="17 2.01 cM" gene 1..660 /gene="Cldn20" /gene_synonym="EG621628" /note="claudin 20" /db_xref="GeneID:621628" /db_xref="MGI:MGI:3646757" CDS 1..660 /gene="Cldn20" /gene_synonym="EG621628" /codon_start=1 /product="claudin-20 precursor" /protein_id="NP_001095030.1" /db_xref="CCDS:CCDS49928.1" /db_xref="GeneID:621628" /db_xref="MGI:MGI:3646757" /translation="
MASAGLQLLAFILAVSGVSGVLAATLLPNWKVNAYAGPNIVTAVVQVQGLWVDCTWYSTGMFSCTLKYSILSLPVHVQTARATMVLACVLSAWGICTSIAGMNCTHLGGDTHTKSKISFAGGVCFITAGISGLIPTVWYTKEIIANFLDLTIPESHKYEPGGALYIGFISAMLLLISGVIFCTSYIQKNQEPWIYPPKQKLSTTWQPKNRRAHNLKDYM"
sig_peptide 1..69
/gene="Cldn20"
/gene_synonym="EG621628"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
misc_feature 13..543
/gene="Cldn20"
/gene_synonym="EG621628"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
exon 1..660
/gene="Cldn20"
/gene_synonym="EG621628"
/inference="alignment:Splign:2.1.0"
ORIGIN
atggcctcggcaggtctccagctccttgctttcatcctggccgtgtctggggtgtctggagtactcgctgccactctgctgccaaactggaaggttaatgcatacgcaggacccaacattgtaactgctgttgtccaggtgcaggggttgtgggtggactgcacgtggtacagcactgggatgtttagctgcactctaaaatactccattctgtcgctccccgtccatgtgcagactgcgagggccaccatggtcctggcctgtgttctgtctgcttgggggatttgtacttcgatagcaggaatgaactgcactcacttaggaggagacacacacaccaagagtaaaatttcctttgctggaggagtctgcttcatcactgcagggatctctggtttaatcccaacagtgtggtacaccaaggagatcatagcgaactttctggatctgaccattccggaaagccacaaatatgaacctggaggagccctgtacattgggtttatttcggcgatgctactacttatctctggtgttattttctgcacttcttatatacagaagaaccaagaaccatggatctaccctcccaagcagaaactttccactacctggcagccaaagaacaggcgagcacataacttgaaggattacatgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]