2025-10-22 23:51:03, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001111318 663 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus claudin 24 (Cldn24), mRNA. ACCESSION NM_001111318 XM_001473536 VERSION NM_001111318.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 663) AUTHORS Higashi AY, Higashi T, Furuse K, Ozeki K, Furuse M and Chiba H. TITLE Claudin-9 constitutes tight junctions of folliculo-stellate cells in the anterior pituitary gland JOURNAL Sci Rep 11 (1), 21642 (2021) PUBMED 34737342 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 663) AUTHORS Westmoreland JJ, Drosos Y, Kelly J, Ye J, Means AL, Washington MK and Sosa-Pineda B. TITLE Dynamic distribution of claudin proteins in pancreatic epithelia undergoing morphogenesis or neoplastic transformation JOURNAL Dev Dyn 241 (3), 583-594 (2012) PUBMED 22275141 REFERENCE 3 (bases 1 to 663) AUTHORS Mineta K, Yamamoto Y, Yamazaki Y, Tanaka H, Tada Y, Saito K, Tamura A, Igarashi M, Endo T, Takeuchi K and Tsukita S. TITLE Predicted expansion of the claudin multigene family JOURNAL FEBS Lett 585 (4), 606-612 (2011) PUBMED 21276448 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CH466554.1. On Dec 14, 2007 this sequence version replaced XM_001473536.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is 75% identical to the human homolog. Similar to the human gene, this gene is upstream of the Cldn22 gene, which overlaps the Wwc2 gene on the opposite strand. [provided by RefSeq, Aug 2010]. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..663 /organism="Mus musculus" /mol_type="mRNA" /strain="mixed" /db_xref="taxon:10090" /chromosome="8" /map="8 26.91 cM" gene 1..663 /gene="Cldn24" /gene_synonym="Gm10107" /note="claudin 24" /db_xref="GeneID:100039801" /db_xref="MGI:MGI:3712484" CDS 1..663 /gene="Cldn24" /gene_synonym="Gm10107" /codon_start=1 /product="putative claudin-24" /protein_id="NP_001104788.1" /db_xref="CCDS:CCDS52549.1" /db_xref="GeneID:100039801" /db_xref="MGI:MGI:3712484" /translation="
MAFIFRTAMQSVGLSLSLLGWVLAIITTYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDCLRLGETQEGLKKRLLTLGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACSSPAPAASSHYAGAGPRDHGSYLENGTVQPKV"
misc_feature 19..549 /gene="Cldn24" /gene_synonym="Gm10107" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" exon 1..663 /gene="Cldn24" /gene_synonym="Gm10107" /inference="alignment:Splign:2.1.0" ORIGIN
atggctttcatcttcagaacggccatgcaatcagtagggctttctctgtcattgctgggatgggttctagccattattaccacatatctaccacactggaagaaccttaacttggagctgaacgagatggagaactggaccatggggctctggaaatcctgcgtcatccaggaggaagtcgggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcaggtctccagggtcttgatgtccctgtgcaacgggctggggctgctgggcttgctggcctctggctgtggcctggactgcttgaggcttggagagacacaggagggtctgaagaagcggctgctcaccctgggagggaccctgctctggacctcgggagtcatggtgctagttcctgtctcctgggtggcccacaagacggtgcgggagttctgggatgagaccatgcctgagattgtgcccaggtgggagtttggggaggccctgttcctgggctggtttgctggcttctgcctggtgctaggagggtgtgtgcttcactgtgcagcctgctcgagcccagctcctgcagcctcgagtcactatgcaggggcgggacctcgagatcatggttcatacctagaaaatggaactgtacagcctaaagtgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]