GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-08-18 22:51:45, GGRNA : RefSeq release 89 (Jul, 2018)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Mus musculus claudin 11 (Cldn11), mRNA. (1872 bp)
us claudin 11 (Cldn11), mRNA. ACCESSION NM_008770 VERSION NM_008770.3 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: Claudin-11; Claudin11; Osp; Otm
NM_008770.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1944 bp)
DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. ACCESSION NM_001185023 VERSION NM_001185023.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 3 L homeolog (cldn3.L), mRNA. (2908 bp)
ynonym="claudin-3; cldn3" /note="upstream in-frame stop codon" CDS 376..1017 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /codon_start=1 /product="claudin 3 L homeolog" /protein_id="NP_001087400.1" /db_xref="GeneID:447224" /db_xref="Xenbase:XB-GENE-6078310" /translation="MSMGLEILGVALSIVGWIGSVVCCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILAGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYLGWAASALLMLGGAMLCCSCPPKDKYPPSRVAYTAARSTNPGYDKKDYV" misc_feature 382..915 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /note="PMP-22/EMP/MP20/Claudin family...
Synonym: claudin-3; cldn3
NM_001093931.1 - Xenopus laevis (African clawed frog) - NCBI
Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (2029 bp)
ns claudin 7 (CLDN7), transcript variant 1, mRNA. ACCESSION NM_001307 VERSION NM_001307.5 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On May 29, 2010 this sequence version replaced NM_001307.4. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
JUN-2018 DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. ACCESSION NM_001185022 VERSION NM_001185022.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AJ011497.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Xenopus tropicalis claudin 8, gene 2 (cldn8.2), mRNA. (2062 bp)
XB-GENE-991592" CDS 31..711 /gene="cldn8.2" /gene_synonym="claudin-8" /codon_start=1 /product="claudin 8, gene 2" /protein_id="NP_001120297.1" /db_xref="GeneID:100145356" /db_xref="Xenbase:XB-GENE-991592" /translation="MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV" misc_feature 31..567 /gene="cldn8.2" /gene_synonym="claudin-8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: claudin-8
NM_001126825.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 14 L homeolog (cldn14.L), mRNA. (1338 bp)
gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /codon_start=1 /product="claudin 14 L homeolog" /protein_id="NP_001086045.1" /db_xref="GeneID:444474" /db_xref="Xenbase:XB-GENE-995701" /translation="MASMALQLLGFSVALIGFIGTVVATVLPHWWRTAHVGTNIITAVAYMKGLWMECVWHSTGIYQCQVHQSQLALPRDLQVARAMMVASCVLSVLASVVSVFGMKCTQCAKGSSSKRVIAAFGGVFSALAGLMCLIPVAWSTNDVVQDFYNPGLPYGMKYEIGQALYIGFISGGLSVIGGIMILSTSCQKDSTPLPYTPQRRYPRKTPTSRSQPVNKSNHVPSWSSASHHGYHLNDFV" misc_feature 70..600 /gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: claudin-14; cldn14; DFNB29
NM_001092576.1 - Xenopus laevis (African clawed frog) - NCBI
Pan troglodytes claudin 11 (CLDN11), mRNA. (2174 bp)
="claudin-11" /note="upstream in-frame stop codon" CDS 200..823 /gene="CLDN11" /gene_synonym="claudin-11" /note="claudin 11 (oligodendrocyte transmembrane protein)" /codon_start=1 /product="claudin-11" /protein_id="NP_001233342.1" /db_xref="GeneID:460846" /db_xref="VGNC:VGNC:1780" /translation="MVATFLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV" misc_feature 215..715 /gene="CLDN11" /gene_synonym="claudin-11" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-11
NM_001246413.1 - Pan troglodytes (chimpanzee) - NCBI
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 19 S homeolog (cldn19.S), mRNA. (1944 bp)
"claudin-19; cldn19" /note="upstream in-frame stop codon" CDS 309..974 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /codon_start=1 /product="claudin 19 S homeolog" /protein_id="NP_001088886.1" /db_xref="GeneID:496231" /db_xref="Xenbase:XB-GENE-954660" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIAVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNDERRGQQYYRQSQPSATTREITKMPAKNKEETS" misc_feature 318..854 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-19; cldn19
NM_001095417.1 - Xenopus laevis (African clawed frog) - NCBI
Rattus norvegicus claudin 19 (Cldn19), mRNA. (1626 bp)
gene="Cldn19" /gene_synonym="claudin-19" /note="upstream in-frame stop codon" CDS 85..720 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19" /protein_id="NP_001008514.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREYV" misc_feature 94..630 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-19
NM_001008514.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog (cldn5.S), mRNA. (1060 bp)
gene="cldn5.S" /gene_synonym="claudin-5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog" /protein_id="NP_001085820.1" /db_xref="GeneID:444247" /db_xref="Xenbase:XB-GENE-17332561" /translation="MASVGMEILGLSLSTLGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALSPELQAGRALTVLASMVGLIGLLVTVVGAKCTNCLHGSSVKGRVLLAGGIIYILCGILVLIPLCWIANIIITEFYDPRVPAPQKREMGAALYVGWAATSLLMLGGSLLCGSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 180..677 /gene="cldn5.S" /gene_synonym="claudin-5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-5
NM_001092351.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 19 L homeolog (cldn19.L), mRNA. (1995 bp)
synonym="claudin-19" /note="upstream in-frame stop codon" CDS 248..880 /gene="cldn19.L" /gene_synonym="claudin-19" /codon_start=1 /product="uncharacterized protein LOC494684" /protein_id="NP_001087995.1" /db_xref="GeneID:494684" /db_xref="Xenbase:XB-GENE-17346338" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIGVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNEDRRGQQYYRQSQPSATTREYV" misc_feature 257..793 /gene="cldn19.L" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family;...
Synonym: claudin-19
NM_001094526.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) (cldn5), mRNA. (2593 bp)
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1; claudin-5; cpetrl1; tmvcf
NM_001006706.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Gallus gallus claudin 10 (CLDN10), transcript variant 2, mRNA. (843 bp)
variant 2" /codon_start=1 /product="claudin-10 isoform 2 precursor" /protein_id="NP_001264697.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" sig_peptide 11..79 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 29..427 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-10
NM_001277768.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus claudin 10 (CLDN10), transcript variant 1, mRNA. (963 bp)
product="claudin-10 isoform 1 precursor" /protein_id="NP_001264696.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" sig_peptide 11..79 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 29..547 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: claudin-10
NM_001277767.1 - Gallus gallus (chicken) - NCBI - UCSC
Gallus gallus claudin 10 (CLDN10), transcript variant 3, mRNA. (826 bp)
gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" CDS 24..560 /gene="CLDN10" /gene_synonym="claudin-10" /note="isoform 3 is encoded by transcript variant 3" /codon_start=1 /product="claudin-10 isoform 3" /protein_id="NP_001264698.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MNCAGNALGAFHCRPHLTIFKVEGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" misc_feature <81..410 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: claudin-10
NM_001277769.1 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus laevis claudin 6, gene 2 L homeolog (cldn6.2.L), mRNA. (933 bp)
synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="claudin4L1" /codon_start=1 /product="claudin 6, gene 2 L homeolog" /protein_id="NP_001082332.1" /db_xref="GeneID:398409" /db_xref="Xenbase:XB-GENE-1009651" /translation="MASTGLQVLGMAMSIIGWVGCIITCAMPMWRVTAFIGNNIVVAQIIWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALTVICILVALLAMLVGIVGAKCTNCIEDENTKAKVSMVSGVVFLVAGILMLIPVCWSANSIIRDFYNPLVVEAQKRELGAAIYIGWASSALMLLGGGLLCCSCPKKNDAPYSARYTAPSGPARSDYPSKNYV" misc_feature 61..567 /gene="cldn6.2.L" /gene_synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA
NM_001088863.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 12 S homeolog (cldn12.S), mRNA. (1179 bp)
LOCUS NM_001095510 1179 bp mRNA linear VRT 29-OCT-2016 DEFINITION Xenopus laevis claudin 12 S homeolog (cldn12.S), mRNA. ACCESSION NM_001095510 VERSION NM_001095510.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC088962.1. ##Evidence-Data-START## Transcript exon combination ::...
Synonym: claudin-12; cldn12
NM_001095510.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 12 (cldn12), mRNA. (2983 bp)
LOCUS NM_001016851 2983 bp mRNA linear VRT 28-OCT-2016 DEFINITION Xenopus tropicalis claudin 12 (cldn12), mRNA. ACCESSION NM_001016851 NM_001015839 VERSION NM_001016851.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CR855430.2. On or before Oct 7, 2010 this sequence...
Synonym: claudin-12
NM_001016851.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog (cldn5.L), mRNA. (2376 bp)
cldn5.L" /gene_synonym="claudin-5; cldn5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog" /protein_id="NP_001083445.1" /db_xref="GeneID:398929" /db_xref="Xenbase:XB-GENE-6078354" /translation="MASAAMEIIGLSLSILGWIGVILTCGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALHPELQAGRALTVLASIVGLVGLLVTIVGAKCTNCLQGSSVKSRVLLAGGIIYIVCGILLLVPLCWIANIVITEFYDPRVPASQKREMGAALYIGWGATSLLLLGGSLLCCSFAMKDGISNLPVKYSAPRIPTSNGDYDKKNYV" misc_feature 103..594 /gene="cldn5.L" /gene_synonym="claudin-5; cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: claudin-5; cldn5
NM_001089976.1 - Xenopus laevis (African clawed frog) - NCBI
PREDICTED: Gallus gallus claudin 10 (CLDN10), transcript variant X1, mRNA. (867 bp)
CGNC:13756" /db_xref="GeneID:418790" CDS 30..602 /gene="CLDN10" /gene_synonym="claudin-10" /codon_start=1 /product="claudin-10 isoform X1" /protein_id="XP_025006032.1" /db_xref="GeneID:418790" /db_xref="CGNC:13756" /translation="MLGIQIIAFIFSFCGLAATIAATASNEWKVTSRASSVITATWVFQGLWMNCAGNALGAFHCRPHLTIFKVEGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" misc_feature 36..470 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:328820" ORIGIN //...
Synonym: claudin-10
XM_025150264.1 - Gallus gallus (chicken) - NCBI - UCSC
Sus scrofa claudin 1 (CLDN1), mRNA. (1237 bp)
gene="CLDN1" /gene_synonym="claudin1" /note="upstream in-frame stop codon" CDS 228..863 /gene="CLDN1" /gene_synonym="claudin1" /note="claudin-1 protein" /codon_start=1 /product="claudin-1" /protein_id="NP_001231468.1" /db_xref="GeneID:100625166" /translation="MANAGLQLLGFILAFLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNTTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 240..746 /gene="CLDN1" /gene_synonym="claudin1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin1
NM_001244539.1 - Sus scrofa (pig) - NCBI
Danio rerio claudin 7b (cldn7b), mRNA. (1950 bp)
synonym="cb388; claudin7; cldn7; fd19f08; wu:fd19f08" /note="claudin-like protein ZF4A22; claudin-7" /codon_start=1 /product="claudin-7-B" /protein_id="NP_571712.1" /db_xref="GeneID:60635" /db_xref="ZFIN:ZDB-GENE-001103-5" /translation="MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTGQQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAMTGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGGMLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV" misc_feature 165..701 /gene="cldn7b" /gene_synonym="cb388; claudin7; cldn7; fd19f08; wu:fd19f08" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: cb388; claudin7; cldn7; fd19f08; wu:fd19f08
NM_131637.1 - Danio rerio (zebrafish) - NCBI - UCSC
Mus musculus claudin 16 (Cldn16), mRNA. (1173 bp)
musculus claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins are...
Synonym: claudin-16; PCLN1
NM_053241.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Macaca mulatta claudin 12 (CLDN12), mRNA. (2310 bp)
LOCUS NM_001194860 2310 bp mRNA linear PRI 26-JUN-2017 DEFINITION Macaca mulatta claudin 12 (CLDN12), mRNA. ACCESSION NM_001194860 XM_002803388 VERSION NM_001194860.1 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JSUE03028801.1. On Aug 11, 2010 this...
Synonym: claudin-12
NM_001194860.1 - Macaca mulatta (Rhesus monkey) - NCBI
Gallus gallus claudin 1 (CLDN1), mRNA. (2578 bp)
gene 1..2578 /gene="CLDN1" /note="claudin 1" /db_xref="CGNC:66478" /db_xref="GeneID:424910" CDS 79..714 /gene="CLDN1" /note="tight junction protein" /codon_start=1 /product="claudin-1" /protein_id="NP_001013629.1" /db_xref="CGNC:66478" /db_xref="GeneID:424910" /translation="MASGGLQLLGFVLAFLGWMGIIISTAMPQWKMASYAGDNIVTAQALYEGLWMSCAMQSTGQIQCKVYDSLLKLEGSLQATRALMVAAILLGLVGVFVAVTGMKCMKCMEDDQVKKMRMAVFGGVIFIIAGLSALVATSWYGNRVARAFYDPFTPVNTRFEFGSALFIGWAAASLALLGGAFLCCSCPRSETSYPPSRGYPKNAPSTGKDYV" misc_feature 91..624 /gene="CLDN1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
NM_001013611.2 - Gallus gallus (chicken) - NCBI - UCSC
Sus scrofa claudin 1-like (LOC396566), mRNA. (1012 bp)
gene="LOC396566" /note="claudin 1-like" /db_xref="GeneID:396566" misc_feature 34..36 /gene="LOC396566" /note="upstream in-frame stop codon" CDS 175..810 /gene="LOC396566" /codon_start=1 /product="claudin-1-like" /protein_id="NP_001155107.1" /db_xref="GeneID:396566" /translation="MANAGLQLLGFILAFLGWIGSIVSTALLQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATARYGNRIVQEFYHLMTPVNARYEFGQALFTGWAAASLCLLGGALLCRSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 187..693 /gene="LOC396566" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
NM_001161635.1 - Sus scrofa (pig) - NCBI
Pongo abelii claudin 12 (CLDN12), mRNA. (3502 bp)
Data-START## Transcript exon combination :: CR859386.1, CR557419.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..3502 /organism="Pongo abelii" /mol_type="mRNA" /db_xref="taxon:9601" /chromosome="7" /map="7" gene 1..3502 /gene="CLDN12" /gene_synonym="Claudin-12" /note="claudin 12" /db_xref="GeneID:100174503" exon 2..84 /gene="CLDN12" /gene_synonym="Claudin-12" /inference="alignment:Splign:2.1.0" exon 85..174 /gene="CLDN12" /gene_synonym="Claudin-12" /inference="alignment:Splign:2.1.0" exon 175..3491 /gene="CLDN12" /gene_synonym="Claudin-12" /inference="alignment:...
Synonym: Claudin-12
NM_001133960.1 - Pongo abelii (Sumatran orangutan) - NCBI
Sus scrofa claudin 6 (CLDN6), mRNA. (746 bp)
chromosome="3" /map="3" gene 1..746 /gene="CLDN6" /note="claudin 6" /db_xref="GeneID:100302020" CDS 19..684 /gene="CLDN6" /codon_start=1 /product="claudin-6" /protein_id="NP_001155117.1" /db_xref="GeneID:100302020" /translation="MASAGLQILGIVLTLFGWVNALVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLSGAKCTTCVEDKDTKARLVLTSGIIFVLSGVLTLIPVCWTAHAIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGRSQGSSHYMARYSASAPHTASRGPSEYPTKNYV" misc_feature 31..528 /gene="CLDN6" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
NM_001161645.1 - Sus scrofa (pig) - NCBI
Sus scrofa claudin 22 (CLDN22), mRNA. (681 bp)
chromosome="15" /map="15" gene 1..681 /gene="CLDN22" /note="claudin 22" /db_xref="GeneID:100294683" CDS 12..668 /gene="CLDN22" /codon_start=1 /product="claudin-22" /protein_id="NP_001153557.1" /db_xref="GeneID:100294683" /translation="MALVFRAVAQLAGILLSLLGWVLSCLTNYLPQWKNLNLDLNEMENWTMGLWQTCVIQEEVGWQCKDFDSFLALPAELRISRVLMFLSNGLGFLGLLVSGLGLDCLRIGETQQDVKKRLLILGGVLSWTAGIAALVPVSWVAHVTVQEFWDETLSEVVPRWEFGDALFIGWFAGFFLLLGGCLLSWAACGTRAPLASGHYAVVETGHHRVHPEMKTTHL" misc_feature 39..527 /gene="CLDN22" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
NM_001160085.1 - Sus scrofa (pig) - NCBI
Mus musculus claudin 24 (Cldn24), mRNA. (663 bp)
ulus claudin 24 (Cldn24), mRNA. ACCESSION NM_001111318 XM_001473536 VERSION NM_001111318.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CH466554.1. On Dec 14, 2007 this sequence version replaced XM_001473536.1. Summary: This gene encodes a member of the claudin family. Claudins are...
Synonym: Gm10107
NM_001111318.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 20 (Cldn20), mRNA. (660 bp)
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CH466633.1. On or before Oct 13, 2007 this sequence version replaced XM_904536.1, XM_888581.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: EG621628
NM_001101560.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 9 (Cldn9), mRNA. (1443 bp)
musculus claudin 9 (Cldn9), mRNA. ACCESSION NM_020293 VERSION NM_020293.3 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC154766.2. On Aug 6, 2010 this sequence version replaced NM_020293.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: nmf329
NM_020293.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 8 (CLDN8), mRNA. (777 bp)
chromosome="13" /map="13" gene 1..777 /gene="CLDN8" /note="claudin 8" /db_xref="GeneID:100302021" CDS 59..736 /gene="CLDN8" /codon_start=1 /product="claudin-8" /protein_id="NP_001155118.1" /db_xref="GeneID:100302021" /translation="MASNALQIAGLVLGGVGMVGTVAVTVMPQWRVSAFIGSNIVVFENLWEGLWMNCMRHANIRMQCKIYDSLLALSPDLQASRGLMCTASVLSFLAFMTAILGMKCTRCTSDDEKVKSYILLTAGVLFVLTGFVVLIPVSWVANSIIRDFYNPIVDIAQKRELGEALYIGWTAALVLIAAGALFCCIFCCSERSHSYRYSIPSHRTTQRSYHMEKKSPSVYSRSQYV" misc_feature 71..604 /gene="CLDN8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" STS 135..380 /...
NM_001161646.1 - Sus scrofa (pig) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. (1035 bp)
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160098.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v2, mRNA. (1092 bp)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160097.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. (1143 bp)
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160096.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 20 (CLDN20), mRNA. (744 bp)
CLDN20" /note="claudin 20" /db_xref="GeneID:100153817" CDS 28..687 /gene="CLDN20" /codon_start=1 /product="claudin-20 precursor" /protein_id="NP_001153249.1" /db_xref="GeneID:100153817" /translation="MASAGLQLLAFALALSGVSGVLTATLLPNWKVNVDAGSNIITAIVQLQGLWMDCTWYSTGMFSCSLKDSVLGLPTHVQAARAAMVLACVLSALGICTCTVGMKCTRLGGDRESKSHTCFAGGVCLVSAGISSLTPTVWYTKEIIANFLDLTVPESNKHEPGGAVYIGFISAMLLFISGLIFCTSCVKKRAEALLYPSKQQHIPISQPEDNSAYSLKDYV" sig_peptide 28..87 /gene="CLDN20" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 76..570 /gene="CLDN20" /note="PMP-22/EMP/MP20/Claudin family; Region:...
NM_001159777.1 - Sus scrofa (pig) - NCBI
Rattus norvegicus claudin 3 (Cldn3), mRNA. (1501 bp)
stop codon" CDS 441..1100 /gene="Cldn3" /note="RVP1; ventral prostate.1 protein" /codon_start=1 /product="claudin-3" /protein_id="NP_113888.2" /db_xref="GeneID:65130" /db_xref="RGD:68425" /translation="MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVAGVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALLCCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV" misc_feature 447..941 /gene="Cldn3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" misc_feature 465..527 /gene="Cldn3" /experiment...
NM_031700.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 10 (Cldn10), transcript variant a, mRNA. (1200 bp)
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_023878.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 17 (Cldn17), mRNA. (1172 bp)
Mus musculus claudin 17 (Cldn17), mRNA. ACCESSION NM_181490 VERSION NM_181490.3 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK048287.1. On Apr 5, 2007 this sequence version replaced NM_181490.2. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_181490.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 5 (Cldn5), mRNA. (1442 bp)
gene="Cldn5" /note="claudin 5" /db_xref="GeneID:65131" /db_xref="RGD:68431" exon 1..1427 /gene="Cldn5" /inference="alignment:Splign:2.0.8" CDS 143..799 /gene="Cldn5" /codon_start=1 /product="claudin-5" /protein_id="NP_113889.1" /db_xref="GeneID:65131" /db_xref="RGD:68431" /translation="MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV" misc_feature 155..682 /gene="Cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
NM_031701.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Sus scrofa claudin 4 (CLDN4), mRNA. (1039 bp)
gene 1..1039 /gene="CLDN4" /note="claudin 4" /db_xref="GeneID:733578" misc_feature 157..159 /gene="CLDN4" /note="upstream in-frame stop codon" CDS 163..792 /gene="CLDN4" /codon_start=1 /product="claudin-4" /protein_id="NP_001155109.1" /db_xref="GeneID:733578" /translation="MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVICIILAVLGVLLSVVGGKCTNCVDDESAKAKTMIVAGVVFLLAGLLVMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLMLGGALLCCNCPPRTDKPYSAKYSAARSAPASNYV" misc_feature 172..672 /gene="CLDN4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref...
NM_001161637.1 - Sus scrofa (pig) - NCBI
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. (852 bp)
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160099.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus claudin 1 (Cldn1), mRNA. (3275 bp)
gene="Cldn1" /note="claudin 1" /db_xref="GeneID:65129" /db_xref="RGD:68422" exon 1..402 /gene="Cldn1" /inference="alignment:Splign:2.0.8" CDS 180..815 /gene="Cldn1" /codon_start=1 /product="claudin-1" /protein_id="NP_113887.2" /db_xref="GeneID:65129" /db_xref="RGD:68422" /translation="MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAVIGGIIFVISGLATLVATAWYGNRIVQEFYDPMTPINARYEFGQALFTGWAAASLCLLGGALLSCSCPRKTTSYPTPRPYPKPTPSTGKDYV" misc_feature 192..725 /gene="Cldn1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
NM_031699.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Mus musculus claudin 14 (Cldn14), transcript variant 3, mRNA. (1456 bp)
in the thick ascending limb by regulating the tight-junction protein Claudin14 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 114 (16), E3344-E3353 (2017) PUBMED 28373577 REMARK GeneRIF: High Cldn14 is associated with hypoparathyroidism. REFERENCE 2 (bases 1 to 1456) AUTHORS Gong Y, Himmerkus N, Plain A, Bleich M and Hou J. TITLE Epigenetic regulation of microRNAs controlling CLDN14 expression as a mechanism for renal calcium handling JOURNAL J. Am. Soc. Nephrol. 26 (3), 663-676 (2015) PUBMED 25071082 REMARK GeneRIF: claudin-14-targeting miR-9 and miR-374, rather than promoter of the claudin-14 gene...
Synonym: AI851731
NM_001165926.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. (633 bp)
LOCUS XM_003515547 633 bp mRNA linear ROD 27-MAY-2016 DEFINITION PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. ACCESSION XM_003515547 VERSION XM_003515547.1 DBLINK BioProject: PRJNA72741 KEYWORDS RefSeq. SOURCE Cricetulus griseus (Chinese hamster) ORGANISM Cricetulus griseus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Cricetulus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_003515547.1 - Cricetulus griseus (Chinese hamster) - NCBI
Mus musculus claudin 14 (Cldn14), transcript variant 2, mRNA. (1283 bp)
in the thick ascending limb by regulating the tight-junction protein Claudin14 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 114 (16), E3344-E3353 (2017) PUBMED 28373577 REMARK GeneRIF: High Cldn14 is associated with hypoparathyroidism. REFERENCE 2 (bases 1 to 1283) AUTHORS Gong Y, Himmerkus N, Plain A, Bleich M and Hou J. TITLE Epigenetic regulation of microRNAs controlling CLDN14 expression as a mechanism for renal calcium handling JOURNAL J. Am. Soc. Nephrol. 26 (3), 663-676 (2015) PUBMED 25071082 REMARK GeneRIF: claudin-14-targeting miR-9 and miR-374, rather than promoter of the claudin-14 gene...
Synonym: AI851731
NM_001165925.1 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. (633 bp)
LOCUS XM_007629252 633 bp mRNA linear ROD 27-MAY-2016 DEFINITION PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. ACCESSION XM_007629252 VERSION XM_007629252.1 DBLINK BioProject: PRJNA239316 KEYWORDS RefSeq. SOURCE Cricetulus griseus (Chinese hamster) ORGANISM Cricetulus griseus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Cricetulus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_007629252.1 - Cricetulus griseus (Chinese hamster) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/claudin
lang : en | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.084 | 0.084 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.176 | 0.092 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.182 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]