GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2018-05-24 11:24:28, GGRNA : RefSeq release 87 (Mar, 2018)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Homo sapiens claudin 34 (CLDN34), transcript variant X1, mRNA. (1501 bp)
Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1501 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="X" gene 1..1501 /gene="CLDN34" /gene_synonym="Claudin-34" /note="claudin 34; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="...
Synonym: Claudin-34
XM_006724448.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. (633 bp)
LOCUS XM_003515547 633 bp mRNA linear ROD 27-MAY-2016 DEFINITION PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. ACCESSION XM_003515547 VERSION XM_003515547.1 DBLINK BioProject: PRJNA72741 KEYWORDS RefSeq. SOURCE Cricetulus griseus (Chinese hamster) ORGANISM Cricetulus griseus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Cricetulus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_003515547.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. (633 bp)
LOCUS XM_007629252 633 bp mRNA linear ROD 27-MAY-2016 DEFINITION PREDICTED: Cricetulus griseus claudin-4 (Claudin-4), mRNA. ACCESSION XM_007629252 VERSION XM_007629252.1 DBLINK BioProject: PRJNA239316 KEYWORDS RefSeq. SOURCE Cricetulus griseus (Chinese hamster) ORGANISM Cricetulus griseus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Cricetulus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_007629252.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus claudin-34 (Claudin-18), mRNA. (639 bp)
LOCUS XM_003509997 639 bp mRNA linear ROD 27-MAY-2016 DEFINITION PREDICTED: Cricetulus griseus claudin-34 (Claudin-18), mRNA. ACCESSION XM_003509997 VERSION XM_003509997.1 DBLINK BioProject: PRJNA72741 KEYWORDS RefSeq. SOURCE Cricetulus griseus (Chinese hamster) ORGANISM Cricetulus griseus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Cricetulus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_003509997.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus claudin-34 (Claudin-18), mRNA. (639 bp)
LOCUS XM_007617327 639 bp mRNA linear ROD 27-MAY-2016 DEFINITION PREDICTED: Cricetulus griseus claudin-34 (Claudin-18), mRNA. ACCESSION XM_007617327 VERSION XM_007617327.1 DBLINK BioProject: PRJNA239316 KEYWORDS RefSeq. SOURCE Cricetulus griseus (Chinese hamster) ORGANISM Cricetulus griseus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Cricetulus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_007617327.1 - Cricetulus griseus (Chinese hamster) - NCBI
Ictalurus punctatus claudin 15 (cldn15), mRNA. (1474 bp)
Data-START## Transcript exon combination :: KM870792.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1474 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="7" /map="7" gene 1..1474 /gene="cldn15" /gene_synonym="Claudin-15; CLDN15a" /note="claudin 15" /db_xref="GeneID:108267636" misc_feature 222..224 /gene="cldn15" /gene_synonym="Claudin-15; CLDN15a" /note="upstream in-frame stop codon" CDS 282..953 /gene="cldn15" /gene_synonym="Claudin-15; CLDN15a" /note="claudin 15a" /codon_start=1 /product="claudin 15" /protein_id="NP...
Synonym: Claudin-15; CLDN15a
NM_001329306.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-8-like (LOC108277897), mRNA. (2895 bp)
Data-START## Transcript is intronless :: KM870785.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..2895 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="17" /map="17" gene 1..2895 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="claudin-8-like" /db_xref="GeneID:108277897" misc_feature 893..895 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="upstream in-frame stop codon" CDS 911..1951 /gene="LOC108277897" /gene_synonym="Claudin-8; CLDN8; CLDN8c" /note="claudin 8c" /codon_start=1 /product="...
Synonym: Claudin-8; CLDN8; CLDN8c
NM_001329287.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin 1 (cldn1), mRNA. (1765 bp)
single sample supports all introns SAMN00774075 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1765 /organism="Ictalurus punctatus" /mol_type="mRNA" /db_xref="taxon:7998" /chromosome="17" /map="17" gene 1..1765 /gene="cldn1" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="claudin 1" /db_xref="GeneID:108278410" misc_feature 810..812 /gene="cldn1" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="upstream in-frame stop codon" CDS 882..1547 /gene="cldn1" /gene_synonym="Claudin-10; CLDN10; CLDN26" /note="claudin 26" /codon_start=1 /product="claudin 1 precursor" /...
Synonym: Claudin-10; CLDN10; CLDN26
NM_001329305.1 - Ictalurus punctatus (channel catfish) - NCBI
Pan troglodytes claudin 11 (CLDN11), mRNA. (2174 bp)
="claudin-11" /note="upstream in-frame stop codon" CDS 200..823 /gene="CLDN11" /gene_synonym="claudin-11" /note="claudin 11 (oligodendrocyte transmembrane protein)" /codon_start=1 /product="claudin-11" /protein_id="NP_001233342.1" /db_xref="GeneID:460846" /db_xref="VGNC:VGNC:1780" /translation="MVATFLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV" misc_feature 215..715 /gene="CLDN11" /gene_synonym="claudin-11" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-11
NM_001246413.1 - Pan troglodytes (chimpanzee) - NCBI
Mus musculus claudin 11 (Cldn11), mRNA. (1872 bp)
us claudin 11 (Cldn11), mRNA. ACCESSION NM_008770 VERSION NM_008770.3 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: Claudin-11; Claudin11; Osp; Otm
NM_008770.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus claudin 19 (Cldn19), transcript variant X1, mRNA. (3442 bp)
xref="RGD:1305000" CDS 278..952 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19 isoform X1" /protein_id="XP_006238818.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREPVVKLSTSVKGPLGV" misc_feature 287..823 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458"...
Synonym: claudin-19
XM_006238756.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Pan troglodytes claudin 11 (CLDN11), transcript variant X1, mRNA. (1859 bp)
LOCUS XM_009446623 1859 bp mRNA linear PRI 02-JUN-2016 DEFINITION PREDICTED: Pan troglodytes claudin 11 (CLDN11), transcript variant X1, mRNA. ACCESSION XM_009446623 VERSION XM_009446623.2 DBLINK BioProject: PRJNA10627 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pan. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_006490.4)...
Synonym: claudin-11
XM_009446623.2 - Pan troglodytes (chimpanzee) - NCBI
Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1944 bp)
DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. ACCESSION NM_001185023 VERSION NM_001185023.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (2029 bp)
ns claudin 7 (CLDN7), transcript variant 1, mRNA. ACCESSION NM_001307 VERSION NM_001307.5 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On May 29, 2010 this sequence version replaced NM_001307.4. Summary: This gene encodes a member of the claudin family. Claudins...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.5 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
FEB-2018 DEFINITION Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. ACCESSION NM_001185022 VERSION NM_001185022.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AJ011497.1 and BC071844.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Pongo abelii claudin 12 (CLDN12), mRNA. (3502 bp)
introns :: single sample supports all introns SAMEA2058381, SAMEA2058382 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..3502 /organism="Pongo abelii" /mol_type="mRNA" /db_xref="taxon:9601" /chromosome="7" /map="7" gene 1..3502 /gene="CLDN12" /gene_synonym="Claudin-12" /note="claudin 12" /db_xref="GeneID:100174503" misc_feature 181..183 /gene="CLDN12" /gene_synonym="Claudin-12" /note="upstream in-frame stop codon" CDS 208..942 /gene="CLDN12" /gene_synonym="Claudin-12" /codon_start=1 /product="claudin-12" /protein_id="NP_001127432.1" /db_xref="GeneID:100174503" /...
Synonym: Claudin-12
NM_001133960.1 - Pongo abelii (Sumatran orangutan) - NCBI
Xenopus laevis claudin 18 L homeolog (cldn18.L), mRNA. (2388 bp)
gene="cldn18.L" /gene_synonym="claudin-18; cldn18" /codon_start=1 /product="claudin 18 L homeolog" /protein_id="NP_001083443.1" /db_xref="GeneID:398928" /db_xref="Xenbase:XB-GENE-991174" /translation="MSVTMCQTMGFLVSALGFAGIIAATALDPWSTQDLYDNPVTAVFQYQGLWKSCVQQSSGFTECRPYYTILGLPAMFQAVRALMIVGIVLGAIGLLVAIFSLKCIRIGNMEDSAKANITLTSGIMFILAGLCSIIGVSVFANMLITNFWMTTANMYTGGAISGMGGMGGLQTLQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLMPEESNYKAVSYHVSTKTPGYKTSAYEDKSKKSIYNESRRSEDGKSYPSKYDYV" misc_feature 102..677 /gene="cldn18.L" /gene_synonym="claudin-18; cldn18" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-18; cldn18
NM_001089974.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 3 L homeolog (cldn3.L), mRNA. (2908 bp)
ynonym="claudin-3; cldn3" /note="upstream in-frame stop codon" CDS 376..1017 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /codon_start=1 /product="claudin 3 L homeolog" /protein_id="NP_001087400.1" /db_xref="GeneID:447224" /db_xref="Xenbase:XB-GENE-6078310" /translation="MSMGLEILGVALSIVGWIGSVVCCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILAGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYLGWAASALLMLGGAMLCCSCPPKDKYPPSRVAYTAARSTNPGYDKKDYV" misc_feature 382..915 /gene="cldn3.L" /gene_synonym="claudin-3; cldn3" /note="PMP-22/EMP/MP20/Claudin family...
Synonym: claudin-3; cldn3
NM_001093931.1 - Xenopus laevis (African clawed frog) - NCBI
Gallus gallus claudin 3 (CLDN3), mRNA. (1736 bp)
gene="CLDN3" /gene_synonym="claudin-3" /note="upstream in-frame stop codon" CDS 632..1276 /gene="CLDN3" /gene_synonym="claudin-3" /codon_start=1 /product="claudin-3" /protein_id="NP_989533.1" /db_xref="CGNC:49012" /db_xref="GeneID:374029" /translation="MSMGLEIGGVALSVLGWLCSIICCALPMWRVTAFIGNNIVTAQIIWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALLVVAIVLAVLGLMVAIVGAQCTRCVEDETTKAKITIVSGVIFLLSGIMTLIPVSWSANTIIRDFYNPLVIDAQKRELGTSLYVGWAASALLLFGGALLCCSCPPKDERYAPSKVAYSAPRSAVTSYDKRNYV" misc_feature 638..1138 /gene="CLDN3" /gene_synonym="claudin-3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-3
NM_204202.1 - Gallus gallus (chicken) - NCBI - UCSC
Rattus norvegicus claudin 19 (Cldn19), mRNA. (1626 bp)
gene="Cldn19" /gene_synonym="claudin-19" /note="upstream in-frame stop codon" CDS 85..720 /gene="Cldn19" /gene_synonym="claudin-19" /codon_start=1 /product="claudin-19" /protein_id="NP_001008514.1" /db_xref="GeneID:298487" /db_xref="RGD:1305000" /translation="MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKGRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAILGGSFLCCTCPEPERANSIPQPYRSGPSTAAREYV" misc_feature 94..630 /gene="Cldn19" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-19
NM_001008514.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin-4-like (LOC108280887), mRNA. (1929 bp)
synonym="CLDN5c" /note="claudin-4-like" /db_xref="GeneID:108280887" CDS 130..783 /gene="LOC108280887" /gene_synonym="CLDN5c" /note="claudin 5c" /codon_start=1 /product="claudin-4-like" /protein_id="NP_001316230.1" /db_xref="GeneID:108280887" /translation="MASAGLEILGMILSVAGWLGAMVACCLPMWRVAAYVGQNIVITQVVWEGLWMSCVVQSTGQMHCQIYDSMLALPSDLQAARALVVITVFIGVVAMTLAVAGAKCTNCTSDVSSKPRIMLGAGAAFGSAGAVCWSAYTIVLDFHDPLLQDTQKREFGNSLYFGWGASCLLILGGAILSCSCSSRATKDPASTGAQYSVVKSVAANGYCRRDYV" misc_feature 142..672 /gene="LOC108280887" /gene_synonym="CLDN5c" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: CLDN5c
NM_001329301.1 - Ictalurus punctatus (channel catfish) - NCBI
Sus scrofa claudin 1 (CLDN1), mRNA. (1237 bp)
gene="CLDN1" /gene_synonym="claudin1" /note="upstream in-frame stop codon" CDS 228..863 /gene="CLDN1" /gene_synonym="claudin1" /note="claudin-1 protein" /codon_start=1 /product="claudin-1" /protein_id="NP_001231468.1" /db_xref="GeneID:100625166" /translation="MANAGLQLLGFILAFLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNTTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAVIGGVIFLISGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPSPSSGKDYV" misc_feature 240..746 /gene="CLDN1" /gene_synonym="claudin1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin1
NM_001244539.1 - Sus scrofa (pig) - NCBI
Xenopus tropicalis claudin 8, gene 2 (cldn8.2), mRNA. (2062 bp)
XB-GENE-991592" CDS 31..711 /gene="cldn8.2" /gene_synonym="claudin-8" /codon_start=1 /product="claudin 8, gene 2" /protein_id="NP_001120297.1" /db_xref="GeneID:100145356" /db_xref="Xenbase:XB-GENE-991592" /translation="MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV" misc_feature 31..567 /gene="cldn8.2" /gene_synonym="claudin-8" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: claudin-8
NM_001126825.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 14 L homeolog (cldn14.L), mRNA. (1338 bp)
gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /codon_start=1 /product="claudin 14 L homeolog" /protein_id="NP_001086045.1" /db_xref="GeneID:444474" /db_xref="Xenbase:XB-GENE-995701" /translation="MASMALQLLGFSVALIGFIGTVVATVLPHWWRTAHVGTNIITAVAYMKGLWMECVWHSTGIYQCQVHQSQLALPRDLQVARAMMVASCVLSVLASVVSVFGMKCTQCAKGSSSKRVIAAFGGVFSALAGLMCLIPVAWSTNDVVQDFYNPGLPYGMKYEIGQALYIGFISGGLSVIGGIMILSTSCQKDSTPLPYTPQRRYPRKTPTSRSQPVNKSNHVPSWSSASHHGYHLNDFV" misc_feature 70..600 /gene="cldn14.L" /gene_synonym="claudin-14; cldn14; DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: claudin-14; cldn14; DFNB29
NM_001092576.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 3 (cldn3), mRNA. (2814 bp)
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym: claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis claudin 19 S homeolog (cldn19.S), mRNA. (1944 bp)
"claudin-19; cldn19" /note="upstream in-frame stop codon" CDS 309..974 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /codon_start=1 /product="claudin 19 S homeolog" /protein_id="NP_001088886.1" /db_xref="GeneID:496231" /db_xref="Xenbase:XB-GENE-954660" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIAVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNDERRGQQYYRQSQPSATTREITKMPAKNKEETS" misc_feature 318..854 /gene="cldn19.S" /gene_synonym="claudin-19; cldn19" /note="PMP-22/EMP/MP20/Claudin...
Synonym: claudin-19; cldn19
NM_001095417.1 - Xenopus laevis (African clawed frog) - NCBI
Ictalurus punctatus claudin-3-like (LOC108279106), mRNA. (4018 bp)
codon" CDS 1096..1758 /gene="LOC108279106" /gene_synonym="CLDN3d" /note="claudin 3d" /codon_start=1 /product="claudin-3-like" /protein_id="NP_001316458.1" /db_xref="GeneID:108279106" /translation="MAALGLEILGISLSVLGCILSIVCCALPMWRVSAFIGNNIITAQVFWEGIWMNCVYQSTGQMQCKVYDSILALPQDLQAARALTVVAVVLGILALLVSIVGAKCTNCIEDEVAKARVMIVSGVIFITAAITQLIPVSWSANKIIREFYSPIVPEAQKREIGASLYLGWGAAAMLLVGGSILCCSCPPAEKQAKYIPASHVAYSTTKRSVAPSSYSRKDYV" misc_feature 1108..1638 /gene="LOC108279106" /gene_synonym="CLDN3d" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
Synonym: CLDN3d
NM_001329529.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus putative claudin-24 (LOC108270652), mRNA. (1626 bp)
codon" CDS 142..810 /gene="LOC108270652" /gene_synonym="CLDN33a" /note="claudin 33a" /codon_start=1 /product="putative claudin-24" /protein_id="NP_001316204.1" /db_xref="GeneID:108270652" /translation="MDPGVCVLELLGLFFSLSAWLFSLTTTLMSQWLTLSTALLPAESYELGLWGTCVVQELGILECRPYDSLLGLPPDIRLARILMCATLATGFMGISFAIPGINLVNSCKGTETLREKKMLKMVGGVLCFTAGVMGLVPVSYIAHLTVLRFFDESVPDVVPRWEFGQALFWGWTAALLYIVAGSLLITSCICLQDVPCPLPESVPLRGGHASPELSPRRRTEYV" misc_feature 163..693 /gene="LOC108270652" /gene_synonym="CLDN33a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
Synonym: CLDN33a
NM_001329275.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-like protein ZF-A89 (LOC108278486), mRNA. (1402 bp)
codon" CDS 53..688 /gene="LOC108278486" /gene_synonym="CLDN29a" /note="claudin 29a" /codon_start=1 /product="claudin-like protein ZF-A89" /protein_id="NP_001316219.1" /db_xref="GeneID:108278486" /translation="MASAGLQVLGLALALFGLLGDIIICALPMWRVTAFIGQNIVTAQTFWEGLWMNCVMQSTGQMQCKIYDSMLALPQDLQAARALVVISILLTLFGLLLAIAGGKCTNCIEDEPTKARVSVAAGVFFLVGGVLCLIPVCWSAHTVIMDFYNPTLADARKRELGASLFVGWGAAALLLVGGALFCSQCPKTEYRGYSAKYTAPRSNAHGGGNYV" misc_feature <182..595 /gene="LOC108278486" /gene_synonym="CLDN29a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
Synonym: CLDN29a
NM_001329290.1 - Ictalurus punctatus (channel catfish) - NCBI
Rattus norvegicus claudin 20 (Cldn20), mRNA. (660 bp)
CDS 1..660 /gene="Cldn20" /codon_start=1 /product="claudin-20 precursor" /protein_id="NP_001102864.1" /db_xref="GeneID:680178" /db_xref="RGD:1595446" /translation="MASAGLQLLAFILAVSGVSGVLAATLLPNWKVNADAGSTIVTAIVQVHGLWMDCTWYSTGMFSCTLKYSILSLPVYVQAARATMVLACILSALGICTAIVGMKCTHLGGDAHTKSHISFAGGVCFITAGISALIPTVWYTKEIISNFLDLTVPESHKYEPGGAVYIGFISAMLLLIAGIIFCISYIKKNQEPWIYPPKQRLTSTWQPKNRLAYNLKDYV" sig_peptide 1..69 /gene="Cldn20" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 13..543 /gene="Cldn20" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
NM_001109394.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog (cldn5.S), mRNA. (1060 bp)
gene="cldn5.S" /gene_synonym="claudin-5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) S homeolog" /protein_id="NP_001085820.1" /db_xref="GeneID:444247" /db_xref="Xenbase:XB-GENE-17332561" /translation="MASVGMEILGLSLSTLGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALSPELQAGRALTVLASMVGLIGLLVTVVGAKCTNCLHGSSVKGRVLLAGGIIYILCGILVLIPLCWIANIIITEFYDPRVPAPQKREMGAALYVGWAATSLLMLGGSLLCGSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 180..677 /gene="cldn5.S" /gene_synonym="claudin-5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym: claudin-5
NM_001092351.1 - Xenopus laevis (African clawed frog) - NCBI
Rattus norvegicus claudin 22 (Cldn22), mRNA. (1010 bp)
map="16q11" gene 1..1010 /gene="Cldn22" /note="claudin 22" /db_xref="GeneID:306454" /db_xref="RGD:1305271" CDS 48..710 /gene="Cldn22" /codon_start=1 /product="claudin-22" /protein_id="NP_001103613.1" /db_xref="GeneID:306454" /db_xref="RGD:1305271" /translation="MGLVFRTATQSAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHQQHLELKQANPEV" misc_feature <192..596 /gene="Cldn22" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
NM_001110143.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Xenopus laevis claudin 19 L homeolog (cldn19.L), mRNA. (1995 bp)
synonym="claudin-19" /note="upstream in-frame stop codon" CDS 248..880 /gene="cldn19.L" /gene_synonym="claudin-19" /codon_start=1 /product="uncharacterized protein LOC494684" /protein_id="NP_001087995.1" /db_xref="GeneID:494684" /db_xref="Xenbase:XB-GENE-17346338" /translation="MANSGFQLLGYFLALGGWIGIISTTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIIISVVGMKCTKVGDNNPITKSRIAVSGGVLFLLAGLCTLIGVSWYATQVTHDFFNPNTPVNARYEFGSALFVGWASASLTMLGGSFLCCSCPNEDRRGQQYYRQSQPSATTREYV" misc_feature 257..793 /gene="cldn19.L" /gene_synonym="claudin-19" /note="PMP-22/EMP/MP20/Claudin family;...
Synonym: claudin-19
NM_001094526.1 - Xenopus laevis (African clawed frog) - NCBI
Ictalurus punctatus putative claudin-24 (LOC108255719), mRNA. (1510 bp)
CDS 655..1350 /gene="LOC108255719" /gene_synonym="CLDN33c" /note="claudin 33c" /codon_start=1 /product="putative claudin-24" /protein_id="NP_001316176.1" /db_xref="GeneID:108255719" /translation="MYRERKEPELTMVLLTTKIVQRASLFVAFGGLVTTFITTFLPLWKTMNSELNEMENWYEGLWHMCIFTEEVGLHCKAFESLLALPPVTLASRILMCVSIATGFLGVLAAFFGLDGVEIGAGRDRLKRGLLILGGVLIWVSGLTTLAPVSLIAYVMVVEFWDGGLPDVMPRWEYGEAMFSAWFSGLLLVIGGSFIFVAVCMRDHEEKQQREIFSPAHELQPRTQHYLKTEVL" misc_feature 727..1227 /gene="LOC108255719" /gene_synonym="CLDN33c" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
Synonym: CLDN33c
NM_001329247.1 - Ictalurus punctatus (channel catfish) - NCBI
Xenopus tropicalis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) (cldn5), mRNA. (2593 bp)
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1; claudin-5; cpetrl1; tmvcf
NM_001006706.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Oryctolagus cuniculus claudin 1 (CLDN1), mRNA. (609 bp)
xref="taxon:9986" /chromosome="14" /map="14" gene 1..609 /gene="CLDN1" /note="claudin 1" /db_xref="GeneID:100037713" CDS 1..609 /gene="CLDN1" /codon_start=1 /product="claudin-1" /protein_id="NP_001082785.1" /db_xref="GeneID:100037713" /translation="MASMGLQVMGFILAFLGWIGSIVSTALPQWKIYSYAGDSIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKFMKCMEDDEEQKMRMAVIGGVIFLISGLATLVATAWYGNRIVQEFYDPLTPVNSRYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPVPAAPWTP" misc_feature 10..519 /gene="CLDN1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
NM_001089316.1 - Oryctolagus cuniculus (rabbit) - NCBI
Ictalurus punctatus claudin-like protein ZF-A89 (LOC108280691), mRNA. (1796 bp)
codon" CDS 619..1257 /gene="LOC108280691" /gene_synonym="CLDN28a" /note="claudin 28a" /codon_start=1 /product="claudin-like protein ZF-A89" /protein_id="NP_001316228.1" /db_xref="GeneID:108280691" /translation="MVSMCRQMLGYGLGIIGFLGTIIVCALPMWKVTAFIGANIVTAQIIWEGLWMTCVMQSTGQMQCKIYDSMLALPQDLQAARALIIISIIVCLFAMILGINGGKCTNFVENESKKIKVAIASGVTFIIAGVLCLIPVCWSTNTIIQDFYSPMVNSAQKRELGAALYIGFGTAALLILGGGLLCSSCPPQEEKNYNNGYKYSQPRSIANSKAYV" misc_feature 628..1119 /gene="LOC108280691" /gene_synonym="CLDN28a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
Synonym: CLDN28a
NM_001329299.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-4-like (LOC108258715), mRNA. (1490 bp)
stop codon" CDS 269..925 /gene="LOC108258715" /gene_synonym="CLDN31a" /note="claudin 31a" /codon_start=1 /product="claudin-4-like" /protein_id="NP_001316179.1" /db_xref="GeneID:108258715" /translation="MATTGLQVLGLLVSIAGWVGGILVCAAPFWRVSAFVADELVVSQVLWEGLWMTCLSQLGRIQCKVYDSALALSGSTQFCRVMVILSILFGLLAVPLGVIGMKCTHCIEGARDVKTRLVRTAGGIFMAAGVAFFLPIFWTTFSVIRDFYDPNVAPPLKRELGPALYLGGGVAFMMLVGGVMLYQGGSAPSGVPTKPTFGKGAGPAKDNPTEGKQDKAYV" misc_feature 278..811 /gene="LOC108258715" /gene_synonym="CLDN31a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
Synonym: CLDN31a
NM_001329250.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-11-like (LOC108278399), mRNA. (1222 bp)
stop codon" CDS 420..1073 /gene="LOC108278399" /gene_synonym="CLDN11c" /note="claudin 11c" /codon_start=1 /product="claudin-11-like" /protein_id="NP_001316218.1" /db_xref="GeneID:108278399" /translation="MASACLQLSGFFLSVLGWICVIISTSTSDWVILCKYSMNTCRKMDELETKGLWEQCVISTALYHCYSLNQILELPVYIQTCRALMISACILGLPAAALLLSSMPCIHLGEDSVNDKNKRSVIGGILMLIVAMFSVVSTVWFPVGAHQELRLMSFGFSLYSGWVGGALSLLGGCILTCCSIDSTPSYHQNNRYSYYSKQNPPTNQTPPTSNHAKTAQV" misc_feature 435..944 /gene="LOC108278399" /gene_synonym="CLDN11c" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
Synonym: CLDN11c
NM_001329289.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-4-like (LOC108278543), mRNA. (1338 bp)
gene_synonym="CLDN30d" /note="claudin 30d" /codon_start=1 /product="claudin-4-like" /protein_id="NP_001316220.1" /db_xref="GeneID:108278543" /translation="MASQGIHLLGSILALLGWVGVLLSCIIPMWRVTSFMGATIVTSEIIWEGIWMNCVVQSTGQMQCDPYDSMLVLNSDLKAAQVLTVASLLTGSLGIILAFIGGKYTRFLDYSSGAAKDRVATAAGVTLIISALLCLIPVTWAAVAVIQIFYNPQIIDAQRREIGAAIYIGWGASILLLLGGGMLCSTSCSQKAEDDSPLVNYRFVRSSGAGSSIRSSRHIRLHSPSQNRKILVRSDGASVNHHKTTSEGSKKSKTSTTKSEEPMIEPERSDGPSTKSQLNHLGSDHSLGSSESEVASSCPEKTYI" misc_feature 218..727 /gene="LOC108278543" /gene_synonym="CLDN30d" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: CLDN30d
NM_001329291.1 - Ictalurus punctatus (channel catfish) - NCBI
Xenopus laevis claudin 6, gene 2 L homeolog (cldn6.2.L), mRNA. (933 bp)
synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="claudin4L1" /codon_start=1 /product="claudin 6, gene 2 L homeolog" /protein_id="NP_001082332.1" /db_xref="GeneID:398409" /db_xref="Xenbase:XB-GENE-1009651" /translation="MASTGLQVLGMAMSIIGWVGCIITCAMPMWRVTAFIGNNIVVAQIIWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALTVICILVALLAMLVGIVGAKCTNCIEDENTKAKVSMVSGVVFLVAGILMLIPVCWSANSIIRDFYNPLVVEAQKRELGAAIYIGWASSALMLLGGGLLCCSCPKKNDAPYSARYTAPSGPARSDYPSKNYV" misc_feature 61..567 /gene="cldn6.2.L" /gene_synonym="claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA" /note="PMP-22/EMP/MP20/Claudin family; Region...
Synonym: claudin A; cldn4L1; cldn6.2; cldna; Xcla; XclnA
NM_001088863.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 12 S homeolog (cldn12.S), mRNA. (1179 bp)
LOCUS NM_001095510 1179 bp mRNA linear VRT 29-OCT-2016 DEFINITION Xenopus laevis claudin 12 S homeolog (cldn12.S), mRNA. ACCESSION NM_001095510 VERSION NM_001095510.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC088962.1. ##Evidence-Data-START## Transcript exon combination ::...
Synonym: claudin-12; cldn12
NM_001095510.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus laevis claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog (cldn5.L), mRNA. (2376 bp)
cldn5.L" /gene_synonym="claudin-5; cldn5" /codon_start=1 /product="claudin 5 (transmembrane protein deleted in velocardiofacial syndrome) L homeolog" /protein_id="NP_001083445.1" /db_xref="GeneID:398929" /db_xref="Xenbase:XB-GENE-6078354" /translation="MASAAMEIIGLSLSILGWIGVILTCGLPMWQVSAFIENNIVVAQIIWEGLWMTCVVQSTGQMQCKVYDSILALHPELQAGRALTVLASIVGLVGLLVTIVGAKCTNCLQGSSVKSRVLLAGGIIYIVCGILLLVPLCWIANIVITEFYDPRVPASQKREMGAALYIGWGATSLLLLGGSLLCCSFAMKDGISNLPVKYSAPRIPTSNGDYDKKNYV" misc_feature 103..594 /gene="cldn5.L" /gene_synonym="claudin-5; cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: claudin-5; cldn5
NM_001089976.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis claudin 12 (cldn12), mRNA. (2983 bp)
LOCUS NM_001016851 2983 bp mRNA linear VRT 28-OCT-2016 DEFINITION Xenopus tropicalis claudin 12 (cldn12), mRNA. ACCESSION NM_001016851 NM_001015839 VERSION NM_001016851.2 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CR855430.2. On or before Oct 7, 2010 this sequence...
Synonym: claudin-12
NM_001016851.2 - Xenopus tropicalis (tropical clawed frog) - NCBI
Rattus norvegicus claudin 4 (Cldn4), mRNA. (1824 bp)
Cldn4" /note="claudin 4" /db_xref="GeneID:304407" /db_xref="RGD:1307932" misc_feature 186..188 /gene="Cldn4" /note="upstream in-frame stop codon" CDS 192..824 /gene="Cldn4" /codon_start=1 /product="claudin-4" /protein_id="NP_001012022.1" /db_xref="GeneID:304407" /db_xref="RGD:1307932" /translation="MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGLLCCNCPPRRNEKPYSAKYSAARSVPASNYV" misc_feature 201..701 /gene="Cldn4" /note="PMP-22/EMP/MP20/Claudin family; Region:...
NM_001012022.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin-4 (cld4), mRNA. (957 bp)
gene 1..957 /gene="cld4" /note="claudin-4" /db_xref="GeneID:100528651" misc_feature 21..23 /gene="cld4" /note="upstream in-frame stop codon" CDS 51..686 /gene="cld4" /codon_start=1 /product="claudin-4" /protein_id="NP_001187850.1" /db_xref="GeneID:100528651" /translation="MVSQGLQILGVMLSMTGWLGTIITCALPMWRVTAFIGANIVTAQVIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARAMVIISIIVGIFGVLMAVIGGKCTNCMEDESAKAKACIVSGVIFLIAAFLILIPVSWSAQTLIRDFYNPLVLEAQRRELGACLYIGWGSAALLLLGGGLLCWNCPPKENQQYTAAKFAPARSFSPGMNYV" misc_feature 63..566 /gene="cld4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref...
NM_001200921.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-18-like (LOC108278145), mRNA. (1128 bp)
CDS 170..883 /gene="LOC108278145" /gene_synonym="CLDN18b" /note="claudin 18b" /codon_start=1 /product="claudin-18-like" /protein_id="NP_001316217.1" /db_xref="GeneID:108278145" /translation="MATSGLQIGGFLLGVIGVAAVIAATAMNNWSTQDRQGDVVTAVYTYKGLWQDCEVSTSGFTECRPLYGLLGYSAQFQAVRAMMIVSVILGIIAGVISLFSLKCFKMGSTEDSTKAKMTLTAGIMFIIAGICGITGASIYANQIVASFMMTTYNPNYGGMNQMQMEGMGMSMVNRFTFGPPLFVAWIGGGMLLIGGVLKCVAFKGLHAETIPYKTVAYKVPAQSRSAEESSERGQKYV" misc_feature 179..724 /gene="LOC108278145" /gene_synonym="CLDN18b" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN //...
Synonym: CLDN18b
NM_001329288.1 - Ictalurus punctatus (channel catfish) - NCBI
Ictalurus punctatus claudin-10-like (LOC108272376), mRNA. (1266 bp)
gene="LOC108272376" /gene_synonym="CLDN10e" /note="claudin 10e" /codon_start=1 /product="claudin-10-like" /protein_id="NP_001316206.1" /db_xref="GeneID:108272376" /translation="MEVRETQIWGFLLTVLGWIFIACSLAMEGWKVAAAGGQGGSSVVYITWYWSSLWRTCTTSSNAVSNCYDFPVLWSVENNVQIVRALLMGGVAIGILGFILSLVGMECTYIGGKEKEKNRAIFIGSLCHTTSGLLSAAGYAVYARNITAEFFNPSFELKFDLGTPLFVGWAGSIFQFTGGLLYMISIYKLWSLDRRTIEDTVPAEEAVALHSIPTNISNSSDLPSKVSTVSELSLKSSSTLSSVSHKSHHLSKA" misc_feature 407..934 /gene="LOC108272376" /gene_synonym="CLDN10e" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" ORIGIN...
Synonym: CLDN10e
NM_001329277.1 - Ictalurus punctatus (channel catfish) - NCBI
Mus musculus claudin 16 (Cldn16), mRNA. (1173 bp)
musculus claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins are...
Synonym: claudin-16; PCLN1
NM_053241.5 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Ictalurus punctatus claudin-like protein zf-a89 (cldy), mRNA. (1077 bp)
gene="cldy" /note="claudin-like protein zf-a89" /db_xref="GeneID:100528311" misc_feature 55..57 /gene="cldy" /note="upstream in-frame stop codon" CDS 64..708 /gene="cldy" /codon_start=1 /product="claudin-like protein zf-a89" /protein_id="NP_001187510.1" /db_xref="GeneID:100528311" /translation="MVSAGLQMLGAALGIIGWIGVIVVCALPMWRVTAFIGSNIVTSQIQWEGIWMNCVVQSTGQMQCKVYDSMLALSSDLQAARALTVISIVVGIFGILLAMAGGKCTNCVEDENSKAKVAVAAGVVFIISGVLCLIPVCWTAQTVIRDFYNPLVNQAQKRELGASLFIGWGAAALLIIGGGLLCASCPHNDKPAYTAKYSAPARSQASAPSTKDYV" misc_feature 76..606 /gene="cldy" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
NM_001200581.1 - Ictalurus punctatus (channel catfish) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/claudin
lang : en | div : | spe : | query_string : claudin | format : html | download :

0.000 | 0.000 | search_start;
0.082 | 0.081 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.135 | 0.053 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.141 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]