ver.2
Help
|
Advanced search
|
Japanese
Previous release (v1)
2022-05-22 04:58:18, GGRNA : RefSeq release 210 (Jan, 2022)
Summary:
Results:
Matches are highlighted with green background.
Overlapping matches are dark colored.
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC003688.1, AJ011497.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185022.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2;
claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.2 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185023.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2;
claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.2 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Nov 23, 2018 this sequence version replaced NM_001307.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
CDS 352..993 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /codon_start=1 /product="claudin-3" /protein_id="NP_001005709.1" /db_xref="GeneID:448229" /db_xref="Xenbase:XB-GENE-972426" /translation="MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV" misc_feature 358..891 /gene="cldn3" /gene_synonym="claudin-3; cpe-r2; cpetr2; hrvp1; rvp1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db...
Synonym:
claudin-3; cpe-r2; cpetr2; hrvp1; rvp1
NM_001005709.1 -
Xenopus tropicalis (tropical clawed frog) -
NCBI
Data-START## Transcript exon combination :: CR859386.1, CR557419.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..3502 /organism="Pongo abelii" /mol_type="mRNA" /db_xref="taxon:9601" /chromosome="7" /map="7" gene 1..3502 /gene="CLDN12" /gene_synonym="Claudin-12" /note="claudin 12" /db_xref="GeneID:100174503" misc_feature 181..183 /gene="CLDN12" /gene_synonym="Claudin-12" /note="upstream in-frame stop codon" CDS 208..942 /gene="CLDN12" /gene_synonym="Claudin-12" /codon_start=1 /product="claudin-12" /protein_id="NP_001127432.1" /db_xref="GeneID:100174503" /translation...
Synonym:
Claudin-12
NM_001133960.1 -
Pongo abelii (Sumatran orangutan) -
NCBI
gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /codon_start=1 /product="claudin-5" /protein_id="NP_001006707.1" /db_xref="GeneID:448343" /db_xref="Xenbase:XB-GENE-976044" /translation="MASAAIEILGLSLSILGWVGVILACGLPMWQVSAFIENNIVVAQIIWEGLWMSCVVQSTGQMQCKVYDSILALSQELQAGRALTVMASIVGLIGLLVTIVGAKCTNCLQGNSAKGRVLLAGGVIYILCGILVLIPLCWIANIIITEFYDPRVPASQKREMGAALYVGWAATALLLLGGSLLCCSFAMKDGISNLPVKYSAPRMPTSNGDYDKKNYV" misc_feature 179..676 /gene="cldn5" /gene_synonym="awal; bec1; claudin-5; cpetrl1; tmvcf" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
Synonym: awal; bec1;
claudin-5; cpetrl1; tmvcf
NM_001006706.1 -
Xenopus tropicalis (tropical clawed frog) -
NCBI
gene="CLDN3" /gene_synonym="claudin-3" /inference="alignment:Splign:2.1.0" CDS 87..731 /gene="CLDN3" /gene_synonym="claudin-3" /codon_start=1 /product="claudin-3" /protein_id="NP_989533.1" /db_xref="CGNC:49012" /db_xref="GeneID:374029" /translation="MSMGLEIGGVALSVLGWLCSIICCALPMWRVTAFIGNNIVTAQIIWEGLWMNCVVQSTGQMQCKVYDSMLALPQDLQAARALLVVAIVLAVLGLMVAIVGAQCTRCVEDETTKAKITIVSGVIFLLSGIMTLIPVSWSANTIIRDFYNPLVIDAQKRELGTSLYVGWAASALLLFGGALLCCSCPPKDERYAPSKVAYSAPRSAVTSYDKRNYV" misc_feature 93..593 /gene="CLDN3" /gene_synonym="claudin-3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym:
claudin-3
NM_204202.2 -
Gallus gallus (chicken) -
NCBI -
UCSC
variant 2" /codon_start=1 /product="claudin-10 isoform 2 precursor" /protein_id="NP_001264697.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" sig_peptide 11..79 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 29..427 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Synonym:
claudin-10
NM_001277768.1 -
Gallus gallus (chicken) -
NCBI -
UCSC
gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" CDS 123..659 /gene="CLDN10" /gene_synonym="claudin-10" /note="isoform 3 is encoded by transcript variant 3" /codon_start=1 /product="claudin-10 isoform 3" /protein_id="NP_001264698.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MNCAGNALGAFHCRPHLTIFKVEGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" misc_feature <180..509 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym:
claudin-10
NM_001277769.2 -
Gallus gallus (chicken) -
NCBI -
UCSC
claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins...
misc_feature 257..319 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 293..946 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" misc_feature 368..370 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850;
claudin-25; Cldn25
NM_171826.3 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
product="claudin-10 isoform 1 precursor" /protein_id="NP_001264696.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV" sig_peptide 24..92 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 42..560 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym:
claudin-10
NM_001277767.2 -
Gallus gallus (chicken) -
NCBI -
UCSC
product="claudin domain-containing protein 1 isoform 2" /protein_id="NP_001239379.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature 286..939 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850;
claudin-25; Cldn25
NM_001252450.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
; claudin domain-containing protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 3" /protein_id="NP_001239380.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <616..798 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850;
claudin-25; Cldn25
NM_001252451.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
misc_feature 272..334 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 308..961 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" misc_feature 383..385 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850;
claudin-25; Cldn25
NM_001356488.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
synonym="cb388; claudin7; cldn7; fd19f08; wu:fd19f08" /note="claudin-like protein ZF4A22; claudin-7" /codon_start=1 /product="claudin-7-B" /protein_id="NP_571712.1" /db_xref="GeneID:60635" /db_xref="ZFIN:ZDB-GENE-001103-5" /translation="MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTGQQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAMTGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGGMLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV" misc_feature 165..701 /gene="cldn7b" /gene_synonym="cb388; claudin7; cldn7; fd19f08; wu:fd19f08" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: cb388;
claudin7; cldn7; fd19f08; wu:fd19f08
NM_131637.1 -
Danio rerio (zebrafish) -
NCBI -
UCSC
AA407103; AI849195; AW489850; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..734 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 735..2143 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2143) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain containing 1 contributing to...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850;
claudin-25; Cldn25
NR_045517.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
AA407103; AI849195; AW489850; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..2005 /gene="Cldnd1" /gene_synonym="1110019C08Rik; AA407103; AI849195; AW489850; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2005) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain containing 1 contributing to...
Synonym: 1110019C08Rik; AA407103; AI849195; AW489850;
claudin-25; Cldn25
NR_045518.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
membrane protein claudin-2" /codon_start=1 /product="claudin-2" /protein_id="NP_001003089.1" /db_xref="GeneID:403649" /db_xref="VGNC:VGNC:39316" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVVGGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGIILCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGYV" misc_feature 80..142 /gene="CLDN2" /note="propagated from UniProtKB/Swiss-Prot (Q95KM6.1); transmembrane region" misc_feature 125..601 /gene="CLDN2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin...
NM_001003089.1 -
Canis lupus familiaris (dog) -
NCBI
Gm16492; Gm513" /note="claudin 21, pseudogene; claudin 25, pseudogene" /codon_start=1 /product="putative claudin-25" /protein_id="NP_001371194.1" /db_xref="GeneID:100042785" /db_xref="MGI:MGI:3642767" /translation="MACSFRGRVQLGGLLLSVLGWVCSCVTTVLPQWKTLTLDLNEMETWVSGLWEACVNQEEAGTVCKAFESFLSLPQELQVARILMVASHGLGLLGLLLSSCGLECFRFHRPGGVFKTRLCLLGGTLEASASATTLFPVSWVAYATFQDFWDDSIPEIVPRWEFGDALFLGWAAGLFLAVGGLLLIFSACLENEDGSSSWMADATAPQACAPVEEEFDGSFHLTPRPVNQVI" misc_feature 124..597 /gene="Cldn25" /gene_synonym="Cldn21; Cldn21-ps; Cldn25-ps; Gm16492; Gm513" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: Cldn21; Cldn21-ps; Cldn25-ps; Gm16492; Gm513
NM_001384265.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
gene="Cldn4" /note="upstream in-frame stop codon" CDS 192..824 /gene="Cldn4" /codon_start=1 /product="claudin-4" /protein_id="NP_001012022.1" /db_xref="GeneID:304407" /db_xref="RGD:1307932" /translation="MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGLLCCNCPPRRNEKPYSAKYSAARSVPASNYV" misc_feature 201..701 /gene="Cldn4" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" STS 1438..1594 /gene="Cldn4" /standard_name="...
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160098.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160097.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160096.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_023878.3 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
gene="CLDN5" /note="claudin 5" /db_xref="CGNC:49011" /db_xref="GeneID:374028" exon 1..1752 /gene="CLDN5" /inference="alignment:Splign:2.1.0" CDS 90..740 /gene="CLDN5" /codon_start=1 /product="claudin-5" /protein_id="NP_989532.1" /db_xref="CGNC:49011" /db_xref="GeneID:374028" /translation="MASAAVEILGLGLGILGWVGVILACGLPMWQVSAFIDVNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSILALRPEVQAGRALTVIVALLGLVALMVTVVGAQCTNCIRPGKMKSRIVIAGGTIYILCGVLVLVPLCWFANIVISDFYDPSVPPSQKREIGAALYIGWAATALLLFGGCLICCCSCLQRDETSFPVKYSAPRRPTSSGEYDKKNYV" misc_feature 177..629 /gene="CLDN5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
NM_204201.2 -
Gallus gallus (chicken) -
NCBI -
UCSC
ulus claudin 9 (Cldn9), mRNA. ACCESSION NM_020293 VERSION NM_020293.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC154766.2. On Aug 6, 2010 this sequence version replaced NM_020293.2. Summary: This intronless gene encodes a member of the claudin family. Claudins...
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160099.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
DEFINITION Mus musculus claudin 12 (Cldn12), transcript variant 3, mRNA. ACCESSION NM_001193660 VERSION NM_001193660.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY012969.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane...
musculus claudin 12 (Cldn12), transcript variant 4, mRNA. ACCESSION NM_001193661 VERSION NM_001193661.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY018558.1, AK166110.1, AK128999.1 and AC068663.5. Summary: This gene encodes a member of the claudin family. Claudins are integral...
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY138805.1, AK128999.1 and AC068663.5. On Aug 14, 2009 this sequence version replaced NM_022890.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
note="upstream in-frame stop codon" CDS 481..1200 /gene="Cldn14" /codon_start=1 /product="claudin-14" /protein_id="NP_001013447.1" /db_xref="GeneID:304073" /db_xref="RGD:1309165" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEGPYRPYQPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 547..1023 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:419754" STS 507..751 /gene="Cldn14" /...
gene="Cldn5" /note="claudin 5" /db_xref="GeneID:65131" /db_xref="RGD:68431" exon 1..1427 /gene="Cldn5" /inference="alignment:Splign:2.1.0" CDS 143..799 /gene="Cldn5" /codon_start=1 /product="claudin-5" /protein_id="NP_113889.1" /db_xref="GeneID:65131" /db_xref="RGD:68431" /translation="MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV" misc_feature 155..682 /gene="Cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
note="claudin 24" /db_xref="GeneID:502083" /db_xref="RGD:1562043" CDS 1..663 /gene="Cldn24" /gene_synonym="RGD1562043" /note="claudin 22 like" /codon_start=1 /product="putative claudin-24" /protein_id="NP_001103614.1" /db_xref="GeneID:502083" /db_xref="RGD:1562043" /translation="MAFIFKTAMQSVALSLSLLGWVLAITTTYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGLCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHSSYLENGTAQPKV" misc_feature 19..540 /gene="Cldn24" /gene_synonym="RGD1562043" /note="PMP-22/EMP/MP20/Claudin...
synonym="CLDN33c; si:dkey-98f17.3" /note="claudin 33c; putative claudin-24" /codon_start=1 /product="uncharacterized protein LOC793143 homolog" /protein_id="NP_001316176.1" /db_xref="GeneID:108255719" /translation="MYRERKEPELTMVLLTTKIVQRASLFVAFGGLVTTFITTFLPLWKTMNSELNEMENWYEGLWHMCIFTEEVGLHCKAFESLLALPPVTLASRILMCVSIATGFLGVLAAFFGLDGVEIGAGRDRLKRGLLILGGVLIWVSGLTTLAPVSLIAYVMVVEFWDGGLPDVMPRWEYGEAMFSAWFSGLLLVIGGSFIFVAVCMRDHEEKQQREIFSPAHELQPRTQHYLKTEVL" misc_feature 727..1227 /gene="cldn26" /gene_synonym="CLDN33c; si:dkey-98f17.3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /...
Synonym: CLDN33c; si:dkey-98f17.3
NM_001329247.1 -
Ictalurus punctatus (channel catfish) -
NCBI
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_021386.3. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_021386.4 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
gene="Cldn1" /note="claudin 1" /db_xref="GeneID:65129" /db_xref="RGD:68422" exon 1..402 /gene="Cldn1" /inference="alignment:Splign:2.1.0" CDS 180..815 /gene="Cldn1" /codon_start=1 /product="claudin-1" /protein_id="NP_113887.3" /db_xref="GeneID:65129" /db_xref="RGD:68422" /translation="MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAVIGGIIFVISGLATLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV" misc_feature 192..725 /gene="Cldn1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin;...
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK145504.1 and BG083098.2. On Aug 6, 2010 this sequence version replaced NM_016887.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
DEFINITION Mus musculus claudin 7 (Cldn7), transcript variant 2, mRNA. ACCESSION NM_001193619 VERSION NM_001193619.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL596185.12. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and...
map="16q11" gene 1..1010 /gene="Cldn22" /note="claudin 22" /db_xref="GeneID:306454" /db_xref="RGD:1305271" CDS 48..710 /gene="Cldn22" /codon_start=1 /product="claudin-22" /protein_id="NP_001103613.1" /db_xref="GeneID:306454" /db_xref="RGD:1305271" /translation="MGLVFRTATQSAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQISRILMSLSNGLGLLGLLASGCGLDCLRLGETRKGLKRRLLILGGTLLWTSGVMVLVPVSWVAHMTVQEFWDETVPEIVPRWEFGEALFLGWFAGFCLVLGGCVLHCAACWRPAPPASGHYAVAGLGDHQQHLELKQANPEV" misc_feature <192..596 /gene="Cldn22" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY075485.1, BC085494.1 and AI174044.1. On Aug 3, 2010 this sequence version replaced NM_016675.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
zgc:136892" /note="claudin 30d" /codon_start=1 /product="uncharacterized protein LOC678612 homolog" /protein_id="NP_001316220.1" /db_xref="GeneID:108278543" /translation="MASQGIHLLGSILALLGWVGVLLSCIIPMWRVTSFMGATIVTSEIIWEGIWMNCVVQSTGQMQCDPYDSMLVLNSDLKAAQVLTVASLLTGSLGIILAFIGGKYTRFLDYSSGAAKDRVATAAGVTLIISALLCLIPVTWAAVAVIQIFYNPQIIDAQRREIGAAIYIGWGASILLLLGGGMLCSTSCSQKAEDDSPLVNYRFVRSSGAGSSIRSSRHIRLHSPSQNRKILVRSDGASVNHHKTTSEGSKKSKTSTTKSEEPMIEPERSDGPSTKSQLNHLGSDHSLGSSESEVASSCPEKTYI" misc_feature 218..727 /gene="cldn30" /gene_synonym="CLDN30d; zgc:136892" /note="PMP-22/EMP/MP20/Claudin family; Region:...
Synonym: CLDN30d; zgc:136892
NM_001329291.1 -
Ictalurus punctatus (channel catfish) -
NCBI
Mus musculus claudin 18 (Cldn18), transcript variant A2.1, mRNA. ACCESSION NM_001194921 VERSION NM_001194921.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK033657.1, AF349451.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are integral...
Mus musculus claudin 18 (Cldn18), transcript variant A2.2, mRNA. ACCESSION NM_001194923 VERSION NM_001194923.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF349453.1, AA028634.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are integral...
LOCUS NM_001007037 711 bp mRNA linear VRT 14-OCT-2021 DEFINITION Danio rerio claudin 10a (cldn10a), mRNA. ACCESSION NM_001007037 VERSION NM_001007037.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...SignalP:4.0" misc_feature 10..537 /gene="cldn10a" /gene_synonym="cldn10; dZ52I16.3; si:busm1-52i16.3; si:dz52i16.3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:304458" exon 1..220 /gene="cldn10a" /gene_synonym="cldn10; dZ52I16.3; si:busm1-52i16.3; si:...
Synonym: cldn10; dZ52I16.3; si:busm1-52i16.3; si:dz52i16.3
NM_001007037.1 -
Danio rerio (zebrafish) -
NCBI -
UCSC
TL, Hughes ED, Kawamoto K, Van Itallie CM, Beyer LA, Halsey K, Gardner DJ, Wilcox ER, Rasmussen J, Anderson JM, Dolan DF, Forge A, Raphael Y, Camper SA and Friedman TB. TITLE Claudin 14 knockout mice, a model for autosomal recessive deafness DFNB29, are deaf due to cochlear hair cell degeneration JOURNAL Hum Mol Genet 12 (16), 2049-2061 (2003) PUBMED 12913076 REMARK GeneRIF: To explore the role of claudin 14 in the inner ear and in other tissues we created a mouse model by a targeted deletion of Cldn14. REFERENCE 10 (bases 1 to 1456) AUTHORS Wilcox ER, Burton QL, Naz S, Riazuddin S, Smith TN,...
TL, Hughes ED, Kawamoto K, Van Itallie CM, Beyer LA, Halsey K, Gardner DJ, Wilcox ER, Rasmussen J, Anderson JM, Dolan DF, Forge A, Raphael Y, Camper SA and Friedman TB. TITLE Claudin 14 knockout mice, a model for autosomal recessive deafness DFNB29, are deaf due to cochlear hair cell degeneration JOURNAL Hum Mol Genet 12 (16), 2049-2061 (2003) PUBMED 12913076 REMARK GeneRIF: To explore the role of claudin 14 in the inner ear and in other tissues we created a mouse model by a targeted deletion of Cldn14. REFERENCE 10 (bases 1 to 1283) AUTHORS Wilcox ER, Burton QL, Naz S, Riazuddin S, Smith TN,...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK008821.1. On or before Dec 14, 2007 this sequence version replaced XM_908254.2, XM_887785.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 2210404A22Rik; 5330431C14Rik; 9530051B05Rik
NM_029383.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
LOCUS NM_001398571 735 bp mRNA linear ROD 20-DEC-2021 DEFINITION Rattus norvegicus claudin 25 (Cldn25), mRNA. ACCESSION NM_001398571 XM_002729920 VERSION NM_001398571.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from...
Data Export:
Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.
Debug Info:
Redirect URI : http://ggrna.dbcls.jp/claudin
lang : en |
div : |
spe : |
query_string : claudin |
format : html |
download :
0.000 | 0.000 | search_start;
0.493 | 0.493 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=0&format=json
0.752 | 0.259 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.758 | 0.006 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]