GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 04:40:26, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001015704            2770 bp    mRNA    linear   VRT 22-DEC-2019
DEFINITION  Xenopus tropicalis claudin 1 (cldn1), mRNA.
ACCESSION   NM_001015704
VERSION     NM_001015704.1
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
REFERENCE   1  (bases 1 to 2770)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev. Dyn. 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC089635.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC089635.1, CF376642.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00861988, SAMN00861990
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2770
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8364"
                     /chromosome="5"
                     /map="5"
     gene            1..2770
                     /gene="cldn1"
                     /gene_synonym="claudin-1; cld1; ilvasc; semp1"
                     /note="claudin 1"
                     /db_xref="GeneID:548421"
                     /db_xref="Xenbase:XB-GENE-951609"
     misc_feature    77..79
                     /gene="cldn1"
                     /gene_synonym="claudin-1; cld1; ilvasc; semp1"
                     /note="upstream in-frame stop codon"
     CDS             152..787
                     /gene="cldn1"
                     /gene_synonym="claudin-1; cld1; ilvasc; semp1"
                     /note="Xclaudin 1"
                     /codon_start=1
                     /product="claudin-1"
                     /protein_id="NP_001015704.1"
                     /db_xref="GeneID:548421"
                     /db_xref="Xenbase:XB-GENE-951609"
                     /translation="
MANAGLQLLGFALACLGWIGFIVCIAIPQWKMSSFAGDAIITAQITYEGLWMSCVMQSTGQMQCKTYDSLLKLDSTMQATRALMICGILVGFFAMCIAAVGMKCLTCLQDDEVKKAKVGVVGGALFIVAGLCVLIATAWYGNKIAKDFYNVFTPTNSKYEFGPALFIGWAGAALAILGGALLCCSCPRRETSYPPPRGYNKSAPPAGKDYV"
     misc_feature    164..697
                     /gene="cldn1"
                     /gene_synonym="claudin-1; cld1; ilvasc; semp1"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:328820"
ORIGIN      
cactgatgaactcttccttctccacttttttctgacttgagaaattttcagtctacatttacttaaaggtcctccttagactacagaagagcggacaagctcctgcttcagagggtggccaagtggtaacttattttatccactcaaaaggatggccaacgcaggcttgcaacttttaggattcgccttagcttgtctgggctggattgggtttatagtatgtattgcaatccctcaatggaaaatgtcatcgtttgctggggatgccattatcacagcacagatcacctatgaaggactctggatgtcttgtgtaatgcagagcacagggcagatgcagtgcaaaacctatgactcgctgctgaagctggacagcactatgcaggctacccgagcactgatgatctgcgggattcttgttggtttctttgccatgtgtattgcagcagtagggatgaaatgcttgacatgtcttcaggatgatgaagtgaagaaggcaaaggttggagtagtgggaggagcactcttcattgttgcaggtctctgtgttttaatagccacagcctggtatggaaataaaattgcaaaggatttttacaacgtgttcacaccaaccaattctaaatatgagtttggccctgccttgtttattggatgggccggtgctgcactggcaatccttggaggtgccttgctctgctgctcttgtcccagaagagagacttcctacccaccaccaagaggctacaacaaaagtgcaccacctgctggaaaagattatgtgtaacagaggaacggaaatactgaatagaattactgccatggagacattagaacattattctccacattctcattattcttaaaggcattgcattgccttcagtttcagcaacaaaatacacttgcatccttcttttcagtaacagaacaaggctgtcttgtcatttagcaacccagtacaccagtgacagtgataagttaatgcaggaagatattaaaatcttgaaagtcaacaatatgaatgaaaaaaacagaaggttatacagatgtcagcattaatctaagtcatatttttgtctgtgcaaaacctgcaccctaatccaatacagcatgtctaattataattaaatagactaaaatcaaatagcatgcaaaacagcagcccaggcctctgaatagagggccccacaataaatacaaattagaattgagcaacagatctacagtaatggtagcagcctgtgcagttcagcacaagccattaaagagaacaatccatacgggttgtaaaatccaataccaacaaagcaccctataaagctttttattgtgtttaataaaatgttagtcaatctggcacttataaggtttgcccgcactaagcacaacaacaacagttatatatctcctattctacccgtaatgcttcatataaggagaaattccttatctctagtactttggtgacatgacaaaatatcttccatgagctaaatgtataaatgtgctaaagttgtattacctgatctactatcactgtcatgcacaactctgtgttccaagttttatcccaacaaaaatgtagatgtcagcattcacacttgtcaaaaatctaaggcatccccatactttctatgataaaaattgactgtttaagaaggcaaactgttatattgatgtgtttcagaaagaaaatttgtaatcatgtgccaataaatacaattgcagaactcatagtttactatttacagtacaggcactattctgtgcatctattagaggaaaacattttttgtggcttttttataaaatatcaaaatgtaagctgtagatgaaaatataagatatgtccctacagaatcaataatatgtcaatttaatagtagggatttttactagcaactgttactagcctgttacctgttactagcacctggtgagggcctcttctgggaccaaatatttggccagagctcacagaaaatttataaacatatgtaaacatatcagtcattaagccatagctccaagaatatataggactgcagtgttcagcacctgatcttactgtaactggccttcaaggtgggcttccaaaagtatctaatggagaaaagagacaatcttcccagcttctagactctctctgggctcccctcaaaaacatttttggtaaacattccccattcagttgtgttaagtcatgccaaaaccacttctcctattgtgctgaaaccctgcatccagcactgtgggctaactttatttcagtgagtaaaatatttaggccagcccatggccaactgaatcctgtacaataattttgtcaatattatccagatataaaaaagatagcacctatctctctctttgttacactatggaattctatagcccattcatgtccctttaaagatttacatgattgaagtcattatttcatccttactgtatattatatcttcatttataactagcagcaacaatcatagttctttagccctttcttttggtacaatataaattgttagaatttgttatattttgtgttatttctgtattctaattttttttttgtatgtgactgttattttcaatacgcaatagtaatgaattctgtttcaaggcagaactgaatccaagcatggggtacaatgtacagacatggtttcaggccatttttagtcagttttaatggattactttccttatgtgattttttttaataaataagacttttacaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]