ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-08-13 21:28:52, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001252450 2187 bp mRNA linear ROD 28-APR-2025 DEFINITION Mus musculus claudin domain containing 1 (Cldnd1), transcript variant 2, mRNA. ACCESSION NM_001252450 VERSION NM_001252450.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 2187) AUTHORS Ohnishi,M., Ochiai,H., Matsuoka,K., Akagi,M., Nakayama,Y., Shima,A., Uda,A., Matsuoka,H., Kamishikiryo,J., Michihara,A. and Inoue,A. TITLE Claudin domain containing 1 contributing to endothelial cell adhesion decreases in presence of cerebellar hemorrhage JOURNAL J Neurosci Res 95 (10), 2051-2058 (2017) PUBMED 28244141 REMARK GeneRIF: suggest that the transient decrease of CLDND1 after cerebellar hemorrhage is responsible for low-molecular-weight selective vascular hyperpermeability REFERENCE 2 (bases 1 to 2187) AUTHORS Mineta,K., Yamamoto,Y., Yamazaki,Y., Tanaka,H., Tada,Y., Saito,K., Tamura,A., Igarashi,M., Endo,T., Takeuchi,K. and Tsukita,S. TITLE Predicted expansion of the claudin multigene family JOURNAL FEBS Lett 585 (4), 606-612 (2011) PUBMED 21276448 REFERENCE 3 (bases 1 to 2187) AUTHORS Piao,Y., Ko,N.T., Lim,M.K. and Ko,M.S. TITLE Construction of long-transcript enriched cDNA libraries from submicrogram amounts of total RNAs by a universal PCR amplification method JOURNAL Genome Res 11 (9), 1553-1558 (2001) PUBMED 11544199 REFERENCE 4 (bases 1 to 2187) AUTHORS Mohlke,K.L., Purkayastha,A.A., Westrick,R.J. and Ginsburg,D. TITLE Comparative mapping of distal murine chromosome 11 and human 17q21.3 in a region containing a modifying locus for murine plasma von Willebrand factor level JOURNAL Genomics 54 (1), 19-30 (1998) PUBMED 9806826 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC159200.2. Transcript Variant: This variant (2) uses an alternate internal splice site and initiates translation at an upstream, in-frame start codon, compared to variant 1. The encoded isoform (2) has a longer and distinct N-terminus, compared to isoform 1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: SRR1660821.149219.1, SRR1660811.75950.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849375 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-175 AC159200.2 55504-55678 c 176-219 AC159200.2 54365-54408 c 220-529 AC159200.2 53841-54150 c 530-640 AC159200.2 52176-52286 c 641-778 AC159200.2 50870-51007 c 779-2187 AC159200.2 49341-50749 c FEATURES Location/Qualifiers source 1..2187 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="16" /map="16 34.83 cM" gene 1..2187 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="claudin domain containing 1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" exon 1..175 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" misc_feature 121..123 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="upstream in-frame stop codon" CDS 169..999 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="isoform 2 is encoded by transcript variant 2; claudin domain-containing protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 2" /protein_id="NP_001239379.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="
MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA"
misc_feature 286..939
/gene="Cldnd1"
/gene_synonym="1110019C08Rik; claudin-25; Cldn25"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
exon 176..219
/gene="Cldnd1"
/gene_synonym="1110019C08Rik; claudin-25; Cldn25"
/inference="alignment:Splign:2.1.0"
exon 220..529
/gene="Cldnd1"
/gene_synonym="1110019C08Rik; claudin-25; Cldn25"
/inference="alignment:Splign:2.1.0"
exon 530..640
/gene="Cldnd1"
/gene_synonym="1110019C08Rik; claudin-25; Cldn25"
/inference="alignment:Splign:2.1.0"
exon 641..778
/gene="Cldnd1"
/gene_synonym="1110019C08Rik; claudin-25; Cldn25"
/inference="alignment:Splign:2.1.0"
exon 779..2187
/gene="Cldnd1"
/gene_synonym="1110019C08Rik; claudin-25; Cldn25"
/inference="alignment:Splign:2.1.0"
regulatory 2160..2165
/regulatory_class="polyA_signal_sequence"
/gene="Cldnd1"
/gene_synonym="1110019C08Rik; claudin-25; Cldn25"
/note="hexamer: AATAAA"
polyA_site 2180
/gene="Cldnd1"
/gene_synonym="1110019C08Rik; claudin-25; Cldn25"
/note="major polyA site"
ORIGIN
aaggcccctcggcccagggccgctttggcccggcctggggtggaggtggaggcggaggcgcgggagttatggagggggcgggctctgcagggaagtacgtcagaggaggcgcggggagagtagggtgctgtggtcggagctggagggcgaagccggtggagtgagaggatgggcggtgatagactagagaacaagacttctgtctccgtagcatcttggagcagtctgaatgccagaatggataaccgttttgctactgcgtttgtgattgcttgtgtgcttagtctgatttccaccatctacatggcggcctccataggcacggacttctggtatgagtatcgaagtcccattcaagagaattcaagtgactcgaataaaatcgcctgggaagatttcctcggtgacgaggcggatgagaagacttacaacgatgttctgttccgatacaacggcagcttggggctgtggagacggtgcatcaccatacccaaaaacactcactggtatgcgccaccggaaaggacagagtcatttgatgtggttaccaaatgcatgagtttcacactaaacgagcagttcatggagaagtatgtggaccccggcaaccacaatagcggcatcgacctgcttcgcacctacctgtggcgctgccagttccttttacccttcgtcagcttgggcttgatgtgctttggggcgttgattggcctctgtgcctgtatctgccgcagcctgtatcccaccctcgccactggcattctccatctccttgcaggtctgtgcacactgggctccgtgagttgctatgttgccggcattgaactcttacatcagaaagtagagctgcccaaggatgtatctggagaatttggatggtccttctgcctggcctgcgtctcggctcccttacagttcatggcggccgctctcttcatctgggctgcccacaccaaccggaaagagtacaccttaatgaaggcttatcgtgtggcatgaagggaggctgcctgcttaatgattaatatttttcatacattttttttaactattgaggttttcccttgtcttcctctcagtcgtctttaatttttatttttgtggatatgccattgtattctaaaagccccttttatttatatacagtgccactaaataccatttaaaatgtgtgtggttttcactgagtgacttagtctttttttaccacactgatctaggttcagagttcagacagaaagaactgtagagatgtgacccaagtttgtaaaagaatattagcagtggcaaattgacccaaaacagggtctgctaacgtctgctcagtccagtagtgcagtaactatgaaactagaaatgaatttctgtatgatatctgttatcactgtcagacttcatctttactttcctgttgttgctagcagaaccagcgttcctcaagatgtgtgcacataaaattgggaaatgagctaacatgtgtccctaaactttggtacattactttatttgaggtgaaatatggcagctgtttatactgtgattgtctacaagaaaaaaaaaagtgaaaaatgatgtttacttgaaattgtgcttttaatttcacttcagtgaggaaagttgactaattgtactacactatacctgtttgttttttttttaaactgaaactcatcaggattttcagtgccaccaaaccattgtggatttttgctgctcccctcccccctcccccccacaccaggcttattaaagagtactttctttttaacagagtgagagaagagtcacagccaattcctcaacttctttgttctagctgagtactatatgggaggtcctaccaatatcgaccccccagaactgggggtactaccaccacaagatctaaagctgtagctgccacctactaacctccatttatgggtctttatttcttgtggtgaaatgatgtgcctttccttgcccaaatcccttcctggtgtgtatcaacattacttaatgtcttctaattcagtcatttttttataatatgtcttctgtaaacattgaacttaaaaatcttatttatttactccattattgtagcatttcacagattcaaaaaagtgtaactcagtaatttcttaccaaatcctaaatctgtcttttttaaaaaaataaataaaaaagagaatcatgtagagtgtc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]