GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2024-11-01 10:32:04, GGRNA : RefSeq release 226 (Sep, 2024)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA. (1457 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185023.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185023.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 2, mRNA. (1462 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC003688.1, AJ011497.1 and BC071844.1. On Aug 14, 2020 this sequence version replaced NM_001185022.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001185022.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 7 (CLDN7), transcript variant 1, mRNA. (1542 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CV575841.1, AC003688.1 and BC071844.1. On Nov 23, 2018 this sequence version replaced NM_001307.5. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
Synonym: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
NM_001307.6 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 2 (CLDN2), transcript variant 2, mRNA. (3163 bp)
Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF177340.1, AK075405.1 and AA973123.1. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region...
Synonym: claudin-2; OAZON
NM_001171092.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 2 (CLDN2), transcript variant 3, mRNA. (2921 bp)
This record has been curated by NCBI staff. The reference sequence was derived from AK312515.1, AK075405.1 and AA973123.1. On Aug 13, 2020 this sequence version replaced NM_001171095.1. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5'...
Synonym: claudin-2; OAZON
NM_001171095.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 2 (CLDN2), transcript variant 1, mRNA. (2961 bp)
was derived from DA743944.1, AK075405.1 and AA973123.1. This sequence is a reference standard in the RefSeqGene project. On Jun 2, 2019 this sequence version replaced NM_020384.3. Summary: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated...
Synonym: claudin-2; OAZON
NM_020384.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 2 (CLDN2), transcript variant X1, mRNA. (2904 bp)
CDS 272..964 /gene="CLDN2" /gene_synonym="claudin-2; OAZON" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_054184059.1" /db_xref="GeneID:9075" /db_xref="HGNC:HGNC:2041" /db_xref="MIM:300520" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV" misc_feature 338..814 /gene="CLDN2" /gene_synonym="claudin-2; OAZON" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: claudin-2; OAZON
XM_054328084.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 2 (CLDN2), transcript variant X2, mRNA. (3124 bp)
CDS 492..1184 /gene="CLDN2" /gene_synonym="claudin-2; OAZON" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_054184060.1" /db_xref="GeneID:9075" /db_xref="HGNC:HGNC:2041" /db_xref="MIM:300520" /translation="MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV" misc_feature 558..1034 /gene="CLDN2" /gene_synonym="claudin-2; OAZON" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Synonym: claudin-2; OAZON
XM_054328085.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 5 (CLDN5), transcript variant 5, mRNA. (1699 bp)
PRI 09-JUL-2024 DEFINITION Homo sapiens claudin 5 (CLDN5), transcript variant 5, mRNA. ACCESSION NM_001426402 VERSION NM_001426402.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CP068256.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components...
Synonym: AWAL; BEC1; CPETRL1; TMDVCF; TMVCF
NM_001426402.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin domain containing 2 (CLDND2), transcript variant X9, mRNA. (839 bp)
db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" CDS 292..795 /gene="CLDND2" /codon_start=1 /product="claudin domain-containing protein 2 isoform X2" /protein_id="XP_054175712.1" /db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" /translation="MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL" misc_feature 319..723 /gene="CLDND2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_054319737.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin domain containing 2 (CLDND2), transcript variant X8, mRNA. (852 bp)
db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" CDS 305..808 /gene="CLDND2" /codon_start=1 /product="claudin domain-containing protein 2 isoform X2" /protein_id="XP_054175711.1" /db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" /translation="MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL" misc_feature 332..736 /gene="CLDND2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_054319736.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 10 (CLDN10), transcript variant X1, mRNA. (3898 bp)
gene="CLDN10" /gene_synonym="CPETRL3; HELIX; OSP-L; OSPL" /codon_start=1 /product="claudin-10 isoform X1" /protein_id="XP_054231141.1" /db_xref="GeneID:9071" /db_xref="HGNC:HGNC:2033" /db_xref="MIM:617579" /translation="MRKINKLWLLFMLEKGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV" misc_feature <1686..2003 /gene="CLDN10" /gene_synonym="CPETRL3; HELIX; OSP-L; OSPL" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: CPETRL3; HELIX; OSP-L; OSPL
XM_054375166.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin domain containing 2 (CLDND2), transcript variant X7, mRNA. (1439 bp)
gene="CLDND2" /codon_start=1 /product="claudin domain-containing protein 2 isoform X1" /protein_id="XP_054175710.1" /db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" /translation="MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGKLDSGKRVEETAQKTLTPEAPQLPSQETPGTSRGLPNTLTTPADPAETPLEPQTPVPGALPAIRPRAHLPLPAPHPRPPRLLLSAGRHDHAEHRRHQWIPRVSVTAACLGQNKGTAFFSAAAPRAFLRVVGTQARGCIEAQGRHKDMNS" misc_feature 319..729 /gene="CLDND2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
XM_054319735.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin domain containing 2 (CLDND2), transcript variant X6, mRNA. (1452 bp)
gene="CLDND2" /codon_start=1 /product="claudin domain-containing protein 2 isoform X1" /protein_id="XP_054175709.1" /db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" /translation="MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGKLDSGKRVEETAQKTLTPEAPQLPSQETPGTSRGLPNTLTTPADPAETPLEPQTPVPGALPAIRPRAHLPLPAPHPRPPRLLLSAGRHDHAEHRRHQWIPRVSVTAACLGQNKGTAFFSAAAPRAFLRVVGTQARGCIEAQGRHKDMNS" misc_feature 332..742 /gene="CLDND2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD...
XM_054319734.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 16 (CLDN16), transcript variant X1, mRNA. (3083 bp)
CLDN16" /gene_synonym="HOMG3; PCLN1" /codon_start=1 /product="claudin-16 isoform X1" /protein_id="XP_054200965.1" /db_xref="GeneID:10686" /db_xref="HGNC:HGNC:2037" /db_xref="MIM:603959" /translation="MRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVAGATLLIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV" misc_feature 304..822 /gene="CLDN16" /gene_synonym="HOMG3; PCLN1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919"...
Synonym: HOMG3; PCLN1
XM_054344990.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin 14 (CLDN14), transcript variant X2, mRNA. (2277 bp)
gene="CLDN14" /gene_synonym="DFNB29" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_054180388.1" /db_xref="GeneID:23562" /db_xref="HGNC:HGNC:2035" /db_xref="MIM:605608" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAARALMVISCLLSGIACACAVIGMKCTRCAKGTPAKTTFAILGGTLFILAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYQAPPRATTTTANTAPAYQPPAAYKDNRAPSVTSATHSGYRLNDYV" misc_feature 1269..1745 /gene="CLDN14" /gene_synonym="DFNB29" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919"...
Synonym: DFNB29
XM_054324413.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin domain containing 2 (CLDND2), transcript variant X5, mRNA. (1262 bp)
LOCUS XM_054319738 1262 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens claudin domain containing 2 (CLDND2), transcript variant X5, mRNA. ACCESSION XM_054319738 VERSION XM_054319738.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060943)...
XM_054319738.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 15 (CLDN15), transcript variant 2, mRNA. (1224 bp)
s claudin 15 (CLDN15), transcript variant 2, mRNA. ACCESSION NM_014343 VERSION NM_014343.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AJ245738.1 and AK056103.1. On Jun 2, 2019 this sequence version replaced NM_014343.2. Summary: This gene encodes a member of the claudin family. Claudins...
NM_014343.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 25 (CLDN25), mRNA. (690 bp)
CH471065.1. On or before Oct 4, 2007 this sequence version replaced XM_927777.1, XM_938396.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent...function of claudins JOURNAL Biochim Biophys Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 4 (bases 1 to 690) AUTHORS Katoh,M. and Katoh,M. TITLE CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family JOURNAL...
NM_001101389.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 24 (CLDN24), mRNA. (663 bp)
Jun 9, 2010 this sequence version replaced XM_001714660.1, XM_001716940.1, XM_001716970.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent...function of claudins JOURNAL Biochim Biophys Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 3 (bases 1 to 663) AUTHORS Katoh,M. and Katoh,M. TITLE CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family JOURNAL...
Synonym: CLDN21
NM_001185149.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 182 (TMEM182), transcript variant X5, mRNA. (2010 bp)
protein 182 isoform X4" /protein_id="XP_054196572.1" /db_xref="GeneID:130827" /db_xref="HGNC:HGNC:26391" /translation="MRLNIAIFFGALFGALGVLLFLVAFGSDYWLLATEVGRCSGEKNIENVTFHHEGFFWRCWFNGIVEENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVSLL" misc_feature 230..>523 /gene="TMEM182" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" polyA_site 2010 /gene="TMEM182" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN //...
XM_054340597.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 182 (TMEM182), transcript variant X4, mRNA. (843 bp)
protein 182 isoform X3" /protein_id="XP_054196571.1" /db_xref="GeneID:130827" /db_xref="HGNC:HGNC:26391" /translation="MRGEHNSTSYDSAVIYRGFWAVLMLLGVVAVVIASFLIICAAPFASHFLYKAGGGSYIAADGISSLCYSSLSKSLLSQPLRETSSAINDISLLQALMPLLGWTSHWTCITVGLY" misc_feature 415 /gene="TMEM182" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" polyA_site 843 /gene="TMEM182" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN //...
XM_054340596.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 182 (TMEM182), transcript variant X2, mRNA. (3450 bp)
db_xref="HGNC:HGNC:26391" /translation="MRLNIAIFFGALFGALGVLLFLVAFGSDYWLLATEVGRCSGEKNIENVTFHHEGFFWRCWFNGIVEENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVSILFSLVVMLYVIWVQAVADMESYRNMKMKDCLDFTPSVLYGWSFFLAPAGIFFSLLAGLLFLVVGRHIQIHH" misc_feature 230..709 /gene="TMEM182" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_054340595.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 178A (TMEM178A), transcript variant X9, mRNA. (1560 bp)
id="XP_054196559.1" /db_xref="GeneID:130733" /db_xref="HGNC:HGNC:28517" /translation="MAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV" misc_feature <504..776 /gene="TMEM178A" /gene_synonym="TMEM178" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: TMEM178
XM_054340584.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 178A (TMEM178A), transcript variant X7, mRNA. (1621 bp)
id="XP_054196557.1" /db_xref="GeneID:130733" /db_xref="HGNC:HGNC:28517" /translation="MAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV" misc_feature <565..837 /gene="TMEM178A" /gene_synonym="TMEM178" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: TMEM178
XM_054340582.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 178A (TMEM178A), transcript variant X10, mRNA. (1558 bp)
id="XP_054196560.1" /db_xref="GeneID:130733" /db_xref="HGNC:HGNC:28517" /translation="MAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV" misc_feature <502..774 /gene="TMEM178A" /gene_synonym="TMEM178" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: TMEM178
XM_054340585.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 178A (TMEM178A), transcript variant X8, mRNA. (4492 bp)
id="XP_054196558.1" /db_xref="GeneID:130733" /db_xref="HGNC:HGNC:28517" /translation="MAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV" misc_feature <3436..3708 /gene="TMEM178A" /gene_synonym="TMEM178" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: TMEM178
XM_054340583.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 178A (TMEM178A), transcript variant X6, mRNA. (14794 bp)
id="XP_054196561.1" /db_xref="GeneID:130733" /db_xref="HGNC:HGNC:28517" /translation="MAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV" misc_feature <13738..14010 /gene="TMEM178A" /gene_synonym="TMEM178" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: TMEM178
XM_054340586.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 178B (TMEM178B), transcript variant X2, mRNA. (3982 bp)
MAAGRLLLYTGLSLALCALGMLAVAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYLPLRASRSRLDRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIERCTYIKYHYSSATIPRNLTFNITKTIRQDEWHALHLRRMTAGFMGMAVAIILFGWIIGVLGCCWDRGLMQYVAGLLFLMGGKTGGIKECLPQPGQG" misc_feature 545..>898 /gene="TMEM178B" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_054356978.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens natural killer cell granule protein 7 (NKG7), transcript variant X2, mRNA. (627 bp)
GeneID:4818" /db_xref="HGNC:HGNC:7830" /db_xref="MIM:606008" /translation="MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISAISMVVAMAVYTSERWDQPPHPQIQTFFSWSFYLGWVSAILLLCTGALSLGAHCGGPRPGYETL" misc_feature <267..419 /gene="NKG7" /gene_synonym="GIG1; GMP-17; p15-TIA-1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: GIG1; GMP-17; p15-TIA-1
XM_054321079.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 178B (TMEM178B), transcript variant X4, mRNA. (14666 bp)
misc_feature 545..>901 /gene="TMEM178B" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
XM_054356977.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 182 (TMEM182), transcript variant X1, mRNA. (1083 bp)
translation="MRLNIAIFFGALFGALGVLLFLVAFGSDYWLLATEVGRCSGEKNIENVTFHHEGFFWRCWFNGIVEENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFWAVLMLLGVVAVVIASFLIICAAPFASHFLYKAGGGSYIAADGISSLCYSSLSKSLLSQPLRETSSAINDISLLQALMPLLGWTSHWTCITVGLY" misc_feature 230..>655 /gene="TMEM182" /note="PMP-22/EMP/MP20/Claudin tight junction; Region: Claudin_2; pfam13903" /db_xref="CDD:372799" polyA_site 1083 /gene="TMEM182" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN //...
XM_054340594.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 178A (TMEM178A), transcript variant X3, mRNA. (1412 bp)
misc_feature 131..628 /gene="TMEM178A" /gene_synonym="TMEM178" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: TMEM178
XM_054340580.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens epithelial membrane protein 3 (MAM blood group) (EMP3), transcript variant X1, mRNA. (712 bp)
HGNC:HGNC:3335" /db_xref="MIM:602335" /translation="MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE" misc_feature 195..605 /gene="EMP3" /gene_synonym="YMP" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: YMP
XM_054320174.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 235 (TMEM235), transcript variant X6, mRNA. (958 bp)
misc_feature 299..>625 /gene="TMEM235" /gene_synonym="ARGM1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: ARGM1
XM_054315740.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 235 (TMEM235), transcript variant X5, mRNA. (1916 bp)
misc_feature 299..>625 /gene="TMEM235" /gene_synonym="ARGM1" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: ARGM1
XM_054315739.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens peripheral myelin protein 22 (PMP22), transcript variant X2, mRNA. (543 bp)
HGNC:9118" /db_xref="MIM:601097" /translation="MSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAESNSSQMCGYRD" misc_feature 222..>476 /gene="PMP22" /gene_synonym="CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110
XM_054316517.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 235 (TMEM235), transcript variant X2, mRNA. (2281 bp)
misc_feature 496..1005 /gene="TMEM235" /gene_synonym="ARGM1" /note="PMP-22/EMP/MP20/Claudin tight junction; Region: Claudin_2; pfam13903" /db_xref="CDD:372799" ORIGIN //...
Synonym: ARGM1
XM_054315736.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 235 (TMEM235), transcript variant X4, mRNA. (2159 bp)
misc_feature 299..883 /gene="TMEM235" /gene_synonym="ARGM1" /note="PMP-22/EMP/MP20/Claudin tight junction; Region: Claudin_2; pfam13903" /db_xref="CDD:372799" ORIGIN //...
Synonym: ARGM1
XM_054315738.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 235 (TMEM235), transcript variant X3, mRNA. (2148 bp)
misc_feature 299..883 /gene="TMEM235" /gene_synonym="ARGM1" /note="PMP-22/EMP/MP20/Claudin tight junction; Region: Claudin_2; pfam13903" /db_xref="CDD:372799" ORIGIN //...
Synonym: ARGM1
XM_054315737.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens calcium voltage-gated channel auxiliary subunit gamma 2 (CACNG2), transcript variant X1, mRNA. (4312 bp)
misc_feature <145..438 /gene="CACNG2" /gene_synonym="MRD10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: MRD10
XM_054324980.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens transmembrane protein 235 (TMEM235), transcript variant X1, mRNA. (2235 bp)
misc_feature 299..970 /gene="TMEM235" /gene_synonym="ARGM1" /note="PMP-22/EMP/MP20/Claudin tight junction; Region: Claudin_2; pfam13903" /db_xref="CDD:372799" ORIGIN //...
Synonym: ARGM1
XM_054315735.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens peripheral myelin protein 22 (PMP22), transcript variant X1, mRNA. (3312 bp)
db_xref="MIM:601097" /translation="MSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAALPSLDKSDRAQETTSVFLKDKS" misc_feature 222..>491 /gene="PMP22" /gene_synonym="CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" polyA_site 3312 /gene="PMP22" /gene_synonym="CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN //...
Synonym: CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110
XM_054316516.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens GSG1 like (GSG1L), transcript variant X1, mRNA. (1331 bp)
misc_feature 360..686 /gene="GSG1L" /gene_synonym="PRO19651" /note="GSG1-like protein; Region: GSG-1; pfam07803" /db_xref="CDD:462270" misc_feature <594..995 /gene="GSG1L" /gene_synonym="PRO19651" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN //...
Synonym: PRO19651
XM_054379666.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 17 (CLDN17), mRNA. (1241 bp)
sapiens claudin 17 (CLDN17), mRNA. ACCESSION NM_012131 VERSION NM_012131.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AP000884.1 and BC101503.1. On May 17, 2019 this sequence version replaced NM_012131.2. Summary: This gene encodes a member of the claudin family. Claudins are integral...
NM_012131.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 20 (CLDN20), mRNA. (1209 bp)
sapiens claudin 20 (CLDN20), mRNA. ACCESSION NM_001001346 VERSION NM_001001346.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BC020838.1 and AL139101.13. On Jun 5, 2010 this sequence version replaced NM_001001346.2. Summary: This gene encodes a member of the claudin family. Claudins are...
NM_001001346.3 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin domain containing 2 (CLDND2), transcript variant X4, mRNA. (601 bp)
replace="c" /replace="g" /db_xref="dbSNP:1392241759" CDS 54..557 /gene="CLDND2" /codon_start=1 /product="claudin domain-containing protein 2 isoform X2" /protein_id="XP_047294096.1" /db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" /translation="MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL" misc_feature 81..485 /gene="CLDND2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" variation 56..60 /gene="CLDND2" /replace="gggg" /...
XM_047438140.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
PREDICTED: Homo sapiens claudin domain containing 2 (CLDND2), transcript variant X3, mRNA. (614 bp)
replace="c" /replace="g" /db_xref="dbSNP:1392241759" CDS 67..570 /gene="CLDND2" /codon_start=1 /product="claudin domain-containing protein 2 isoform X2" /protein_id="XP_047294095.1" /db_xref="GeneID:125875" /db_xref="HGNC:HGNC:28511" /translation="MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL" misc_feature 94..498 /gene="CLDND2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" variation 69..73 /gene="CLDND2" /replace="gggg" /...
XM_047438139.1 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 15 (CLDN15), transcript variant 1, mRNA. (2129 bp)
ens claudin 15 (CLDN15), transcript variant 1, mRNA. ACCESSION NM_001185080 VERSION NM_001185080.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK056103.1 and DB158141.1. On Aug 13, 2020 this sequence version replaced NM_001185080.1. Summary: This gene encodes a member of the claudin family. Claudins...
NM_001185080.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Homo sapiens claudin 14 (CLDN14), transcript variant epsilon, mRNA. (1257 bp)
binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 4 (bases 1 to 1257) AUTHORS Kitano,T., Kitajiri,S.I., Nishio,S.Y. and Usami,S.I. TITLE Detailed Clinical Features of Deafness Caused by a Claudin-14 Variant JOURNAL Int J Mol Sci 20 (18), 4579 (2019) PUBMED 31527509 REMARK GeneRIF: This report indicated that claudin-14 is essential for maintaining the inner ear environment and suggested the possible phenotypic expansion of DFNB29. This is the first report of a patient with a tight junction variant receiving a cochlear implantation. Publication Status...
Synonym: DFNB29
NM_012130.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/en/hs/claudin
lang : en | div : | spe : hs | query_string : claudin | format : html | download : 

0.000 | 0.000 | search_start;
0.080 | 0.080 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Homo sapiens (human)?to=0&format=json
0.221 | 0.141 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Homo sapiens (human)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.226 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]