LOCUS       XM_054319735            1439 bp    mRNA    linear   PRI 26-AUG-2024
DEFINITION  PREDICTED: Homo sapiens claudin domain containing 2 (CLDND2),
            transcript variant X7, mRNA.
ACCESSION   XM_054319735
VERSION     XM_054319735.1
DBLINK      BioProject: PRJNA807723
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060943) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_009914755.1-RS_2024_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/23/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1439
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="CHM13"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /sex="female"
                     /cell_line="CHM13htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..1439
                     /gene="CLDND2"
                     /note="claudin domain containing 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1 EST,
                     54 long SRA reads, and 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 4 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:125875"
                     /db_xref="HGNC:HGNC:28511"
     CDS             292..1173
                     /gene="CLDND2"
                     /codon_start=1
                     /product="claudin domain-containing protein 2 isoform X1"
                     /protein_id="XP_054175710.1"
                     /db_xref="GeneID:125875"
                     /db_xref="HGNC:HGNC:28511"
                     /translation="

MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLAVTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAWKNNVFFSWSYFSGWLALPFSILAGKLDSGKRVEETAQKTLTPEAPQLPSQETPGTSRGLPNTLTTPADPAETPLEPQTPVPGALPAIRPRAHLPLPAPHPRPPRLLLSAGRHDHAEHRRHQWIPRVSVTAACLGQNKGTAFFSAAAPRAFLRVVGTQARGCIEAQGRHKDMNS"

     misc_feature    319..729
                     /gene="CLDND2"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      

tgggcgacagagcaagactccatctcaaaaaataataatgataataatgataaaagaaggactcggcctatcatgtaacggcccccaaagctgagatctgaatctaagcagtcactcagttgagagctgcgggggtgtatgcgatggtggtggggggagtgattatccctttaaacagccactgggggagggggttctggaacccctggcctcacagagacccagcctccctccccccgtctctctgggctctgtgtctaaggagccctagggcactgggtcctcagtggcatgggggtgaagcggagcctccagagtgggggcattctgctcagcctcgtggccaacgtcctcatggtgctctccacggccaccaactactggacccgccaacaagagggccacagtggcctgtggcaggaatgcaaccacggcatctgctccagcatcccctgccagaccacgctggcggtgactgtggcgtgcatggtgctggcggtgggtgtcggcgtggtgggcatggtgatgggactgcggattcggtgcgacgagggcgagtcgctgcggggccagaccacgagcgccttcctcttcctcggcggactgctgctgctgaccgccttgataggctacaccgtgaagaatgcgtggaagaacaacgtcttcttctcttggtcctatttttctgggtggctggccttacccttctcaattctcgcgggtaaactggacagcgggaagagggtggaggagactgcccagaagaccctcaccccagaggctccccagctgccctcccaggaaaccccggggacctctcggggactccccaacacactaacgactcccgcagacccggcagagacccccttggagccccaaaccccagtccccggggccctcccggccatccgccccagggcccaccttcctctccctgctccgcacccccgtccccccaggcttctgctttctgctggcagacatgatcatgcagagcaccgacgccatcagtggattccccgtgtgtctgtgactgcagcctgcctggggcagaataaaggaacggctttttttagcgctgcggctccgcgtgcttttctgcgggtcgtggggacgcaggcacggggttgcatagaggctcagggaagacataaggacatgaactcatagggaacgtggagacagggagacacagacatggagacacaagtctccatggattgggatgggaacagggacatgtgggaggggcggggccaggaggggacgtgggcctttggagagggtgtggagaggctgtggggacgacatggaggtgaagtagagacacggacaggggaggatacggatatggaagggacagggaacacggggatggagagagtggagagaccgacgcgcgaggattcagaggcgtgggaatacgagtaccgcga

//