GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-05-22 03:32:44, GGRNA : RefSeq release 210 (Jan, 2022)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. (288 bp)
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This...
XM_024651321.1 - Strongyloides ratti - NCBI
Guyanagaster necrorhizus MCA 3950 PAZ domain-containing protein (BT62DRAFT_1078051), mRNA. (1829 bp)
misc_feature 337..>1434 /locus_tag="BT62DRAFT_1078051" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 1039..1338 /locus_tag="BT62DRAFT_1078051" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order...
XM_043179352.1 - Guyanagaster necrorhizus MCA 3950 - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. (903 bp)
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT...
XM_024650915.1 - Strongyloides ratti - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain and Protein of unknown function DUF2650 family-containing protein (SRAE_2000036100), partial mRNA. (3513 bp)
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 - Strongyloides ratti - NCBI
Geosmithia morbida PAZ domain (GMORB2_2890), partial mRNA. (3108 bp)
misc_feature 490..732 /locus_tag="GMORB2_2890" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 772..921 /locus_tag="GMORB2_2890" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 925..1464 /locus_tag="GMORB2_2890" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_035464866.1 - Geosmithia morbida - NCBI
PREDICTED: Triticum aestivum protein argonaute MEL1-like (LOC123170705), partial mRNA. (675 bp)
codon_start=1 /product="protein argonaute MEL1-like" /protein_id="XP_036.1" /db_xref="GeneID:123170705" /translation="MHIYTITLFPSEYEKEYVIELNEGASEDASRSVSYSVTIHLAKSLKMQELKDYYNGEQSYVSQDILHAINVVVRALSSSCLNAPRAMFSTKFGPIIDTKEGLELWQGCYKGVCLSHYGLDLTIDTTVAPFYKSISMVKFVGEFLGRTDFNRAFSHKEYAKIERALKGVQVETIHHTDRTMKYRIKGLSVVPLKELMFSVDDDGIMTTVVDYYQSRYNCKLEYIHW" misc_feature 91..>666 /gene="LOC123170705" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 397..>675 /gene="LOC123170705" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced...
XM_044588501.1 - Triticum aestivum (bread wheat) - NCBI
PREDICTED: Hordeum vulgare subsp. vulgare protein argonaute 1D-like (LOC123405589), mRNA. (465 bp)
similarity to: 2 Proteins" /db_xref="GeneID:123405589" CDS 1..465 /gene="LOC123405589" /codon_start=1 /product="protein argonaute 1D-like" /protein_id="XP_044955160.1" /db_xref="GeneID:123405589" /translation="MSATTFIEPLPVIDYAAQLLRSDIHSRPLSDAERVKIKKALRGVKVEVTHRGNMRRKYRISGLTTQATRELTFPVDEGGTIKSVVQYFQETYGFAIKHTYLPCLQVGNQQRPNYLPMEKISLGNKQQYQLQMQLFSGDAIRIPRRPIDSSPNSN" misc_feature 25..354 /gene="LOC123405589" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The...
XM_045099225.1 - Hordeum vulgare subsp. vulgare (domesticated barley) - NCBI
Caenorhabditis remanei hypothetical protein (CRE_14480) mRNA, complete cds. (2583 bp)
misc_feature 16..2415 /locus_tag="CRE_14480" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 73..468 /locus_tag="CRE_14480" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 499..651 /locus_tag="CRE_14480" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 652..1014 /locus_tag="CRE_14480" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003107282.1 - Caenorhabditis remanei - NCBI
Caenorhabditis remanei hypothetical protein (CRE_08398) mRNA, complete cds. (2571 bp)
misc_feature 79..2424 /locus_tag="CRE_08398" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 79..477 /locus_tag="CRE_08398" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 508..672 /locus_tag="CRE_08398" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 676..1041 /locus_tag="CRE_08398" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003101857.1 - Caenorhabditis remanei - NCBI
PREDICTED: Acropora millepora protein argonaute-4-like (LOC122956347), mRNA. (1071 bp)
misc_feature 187..>942 /gene="LOC122956347" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 493..858 /gene="LOC122956347" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(649..651,694..696,739..741,751..753,805..807, 826..828,832..834) /gene="LOC122956347" /note="...
XM_044316009.1 - Acropora millepora - NCBI
Caenorhabditis remanei hypothetical protein (CRE_09584) mRNA, complete cds. (2709 bp)
misc_feature 73..2559 /locus_tag="CRE_09584" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 157..573 /locus_tag="CRE_09584" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 604..774 /locus_tag="CRE_09584" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 775..1140 /locus_tag="CRE_09584" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003103769.1 - Caenorhabditis remanei - NCBI
Caenorhabditis remanei hypothetical protein (CRE_25241) mRNA, complete cds. (3177 bp)
misc_feature 250..2931 /locus_tag="CRE_25241" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 316..750 /locus_tag="CRE_25241" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 841..963 /locus_tag="CRE_25241" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1174..1506 /locus_tag="CRE_25241" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003113068.1 - Caenorhabditis remanei - NCBI
Caenorhabditis remanei CRE-ALG-1 protein (Cre-alg-1) mRNA, complete cds. (3069 bp)
feature 424..2865 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 424..840 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature <1009..1110 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1111..1476 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing...
XM_003105478.1 - Caenorhabditis remanei - NCBI
PREDICTED: Mustela putorius furo argonaute RISC component 4 (LOC101680004), transcript variant X3, mRNA. (6519 bp)
misc_feature 470..859 /gene="LOC101680004" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 890..1042 /gene="LOC101680004" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 1043..1405 /gene="LOC101680004" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_045064189.1 - Mustela putorius furo (domestic ferret) - NCBI
PREDICTED: Jaculus jaculus argonaute RISC component 1 (Ago1), transcript variant X1, mRNA. (3526 bp)
misc_feature 210..602 /gene="Ago1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 630..782 /gene="Ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 783..1145 /gene="Ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_004665225.3 - Jaculus jaculus (lesser Egyptian jerboa) - NCBI
PREDICTED: Mustela putorius furo argonaute RISC catalytic component 2 (AGO2), transcript variant X1, mRNA. (14537 bp)
misc_feature 438..662 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 690..842 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 843..1205 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_045078166.1 - Mustela putorius furo (domestic ferret) - NCBI
PREDICTED: Neovison vison argonaute RISC catalytic component 3 (AGO3), transcript variant X4, mRNA. (3859 bp)
misc_feature 175..516 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(310..312,397..399,409..411,463..465,484..486, 490..492) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 649..1926 /gene="AGO3" /note="PIWI domain,...
XM_044237795.1 - Neogale vison (American mink) - NCBI
PREDICTED: Neovison vison argonaute RISC catalytic component 3 (AGO3), transcript variant X3, mRNA. (4097 bp)
misc_feature 413..754 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(548..550,635..637,647..649,701..703,722..724, 728..730) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 887..2164 /gene="AGO3" /note="PIWI domain,...
XM_044237794.1 - Neogale vison (American mink) - NCBI
PREDICTED: Neomonachus schauinslandi protein argonaute-1 (LOC110575417), transcript variant X1, mRNA. (3809 bp)
misc_feature 100..492 /gene="LOC110575417" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 520..672 /gene="LOC110575417" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 673..1035 /gene="LOC110575417" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_044914477.1 - Neomonachus schauinslandi (Hawaiian monk seal) - NCBI
PREDICTED: Mustela putorius furo argonaute RISC catalytic component 2 (AGO2), transcript variant X2, mRNA. (14376 bp)
misc_feature 277..501 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 529..681 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 682..1044 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_004743605.3 - Mustela putorius furo (domestic ferret) - NCBI
PREDICTED: Cervus elaphus argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (15135 bp)
misc_feature 126..467 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(261..263,348..350,360..362,414..416,435..437, 441..443) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 600..1877 /gene="AGO3" /note="PIWI domain,...
XM_043876990.1 - Cervus elaphus (red deer) - NCBI
PREDICTED: Neovison vison argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (4123 bp)
misc_feature 265..417 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 418..780 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(574..576,661..663,673..675,727..729,748..750, 754..756) /gene="AGO3" /note="nucleic acid-binding interface...
XM_044237796.1 - Neogale vison (American mink) - NCBI
PREDICTED: Ursus arctos horribilis argonaute RISC catalytic component 3 (AGO3), transcript variant X8, mRNA. (8578 bp)
misc_feature 121..462 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(256..258,343..345,355..357,409..411,430..432, 436..438) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 595..1872 /gene="AGO3" /note="PIWI domain,...
XM_044390542.1 - Ursus arctos horribilis - NCBI
PREDICTED: Drosophila grimshawi protein argonaute-2 (LOC6569124), transcript variant X2, mRNA. (4348 bp)
misc_feature 595..984 /gene="LOC6569124" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 1012..1164 /gene="LOC6569124" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 1165..1527 /gene="LOC6569124" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_...
XM_032741195.2 - Drosophila grimshawi - NCBI
PREDICTED: Drosophila mojavensis protein argonaute-2 (LOC6580895), transcript variant X4, mRNA. (5407 bp)
misc_feature 1225..1614 /gene="LOC6580895" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 1642..1794 /gene="LOC6580895" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 1795..2157 /gene="LOC6580895" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_032730668.2 - Drosophila mojavensis - NCBI
PREDICTED: Varanus komodoensis argonaute RISC component 4 (AGO4), transcript variant X4, mRNA. (5245 bp)
misc_feature 407..769 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(563..565,608..610,650..652,662..664,716..718, 737..739,743..745) /gene="AGO4" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 908..2215 /gene="AGO4" /note="PIWI...
XM_044424868.1 - Varanus komodoensis (Komodo dragon) - NCBI
PREDICTED: Camelus bactrianus argonaute RISC catalytic component 3 (AGO3), transcript variant X3, mRNA. (6987 bp)
misc_feature 138..479 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(273..275,360..362,372..374,426..428,447..449, 453..455) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 612..1889 /gene="AGO3" /note="PIWI domain,...
XM_045520347.1 - Camelus bactrianus (Bactrian camel) - NCBI
PREDICTED: Ursus arctos horribilis argonaute RISC catalytic component 3 (AGO3), transcript variant X6, mRNA. (10039 bp)
misc_feature 1561..1923 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1717..1719,1804..1806,1816..1818,1870..1872, 1891..1893,1897..1899) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 2056..3333 /gene="AGO3" /note="PIWI...
XM_044390541.1 - Ursus arctos horribilis - NCBI
PREDICTED: Cervus elaphus argonaute RISC component 1 (AGO1), transcript variant X3, mRNA. (6964 bp)
misc_feature 231..383 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 384..746 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(540..542,627..629,639..641,693..695,714..716, 720..722) /gene="AGO1" /note="nucleic acid-binding interface...
XM_043876984.1 - Cervus elaphus (red deer) - NCBI
PREDICTED: Erigeron canadensis protein argonaute MEL1-like (LOC122607154), mRNA. (2278 bp)
misc_feature 321..599 /gene="LOC122607154" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(453..455,498..500,501..503,546..548,567..569, 573..575) /gene="LOC122607154" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 735..1982 /gene="LOC122607154" /...
XM_043780082.1 - Erigeron canadensis - NCBI
PREDICTED: Ursus arctos horribilis argonaute RISC catalytic component 3 (AGO3), transcript variant X9, mRNA. (8589 bp)
misc_feature 132..473 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(267..269,354..356,366..368,420..422,441..443, 447..449) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 606..1883 /gene="AGO3" /note="PIWI domain,...
XM_026516686.2 - Ursus arctos horribilis - NCBI
PREDICTED: Daphnia magna protein argonaute-2 (LOC116918050), transcript variant X4, mRNA. (6272 bp)
misc_feature 662..1051 /gene="LOC116918050" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 1079..1231 /gene="LOC116918050" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 1232..1594 /gene="LOC116918050" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_045168683.1 - Daphnia magna - NCBI
PREDICTED: Cervus canadensis argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (15136 bp)
misc_feature 126..467 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(261..263,348..350,360..362,414..416,435..437, 441..443) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 600..1877 /gene="AGO3" /note="PIWI domain,...
XM_043461928.1 - Cervus canadensis - NCBI
PREDICTED: Ursus arctos horribilis argonaute RISC component 1 (AGO1), transcript variant X3, mRNA. (6703 bp)
misc_feature 139..480 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,361..363,373..375,427..429,448..450, 454..456) /gene="AGO1" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO1" /note="PIWI domain,...
XM_044390544.1 - Ursus arctos horribilis - NCBI
PREDICTED: Drosophila simulans protein argonaute-2 (LOC6734380), transcript variant X3, mRNA. (5187 bp)
misc_feature 744..1133 /gene="LOC6734380" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 1161..1313 /gene="LOC6734380" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 1314..1676 /gene="LOC6734380" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db...
XM_016182061.3 - Drosophila simulans - NCBI
PREDICTED: Jaculus jaculus argonaute RISC component 1 (Ago1), transcript variant X4, mRNA. (2880 bp)
misc_feature 158..499 /gene="Ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(293..295,380..382,392..394,446..448,467..469, 473..475) /gene="Ago1" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 632..1909 /gene="Ago1" /note="PIWI domain,...
XM_045149000.1 - Jaculus jaculus (lesser Egyptian jerboa) - NCBI
PREDICTED: Felis catus argonaute RISC catalytic component 3 (AGO3), transcript variant X9, mRNA. (10109 bp)
misc_feature 131..472 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(266..268,353..355,365..367,419..421,440..442, 446..448) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 605..1882 /gene="AGO3" /note="PIWI domain,...
XM_045035544.1 - Felis catus (domestic cat) - NCBI
PREDICTED: Felis catus argonaute RISC catalytic component 3 (AGO3), transcript variant X7, mRNA. (10158 bp)
misc_feature 180..521 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(315..317,402..404,414..416,468..470,489..491, 495..497) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 654..1931 /gene="AGO3" /note="PIWI domain,...
XM_045035542.1 - Felis catus (domestic cat) - NCBI
PREDICTED: Felis catus argonaute RISC catalytic component 3 (AGO3), transcript variant X10, mRNA. (10138 bp)
misc_feature 160..501 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(295..297,382..384,394..396,448..450,469..471, 475..477) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 634..1911 /gene="AGO3" /note="PIWI domain,...
XM_045035545.1 - Felis catus (domestic cat) - NCBI
PREDICTED: Ursus arctos horribilis argonaute RISC catalytic component 3 (AGO3), transcript variant X7, mRNA. (9928 bp)
misc_feature 1471..1812 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1606..1608,1693..1695,1705..1707,1759..1761, 1780..1782,1786..1788) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1945..3222 /gene="AGO3" /note="PIWI...
XM_026516684.2 - Ursus arctos horribilis - NCBI
PREDICTED: Jaculus jaculus argonaute RISC catalytic component 3 (Ago3), transcript variant X5, mRNA. (3168 bp)
misc_feature 195..536 /gene="Ago3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(330..332,417..419,429..431,483..485,504..506, 510..512) /gene="Ago3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 669..1946 /gene="Ago3" /note="PIWI domain,...
XM_045148897.1 - Jaculus jaculus (lesser Egyptian jerboa) - NCBI
PREDICTED: Jaculus jaculus argonaute RISC catalytic component 3 (Ago3), transcript variant X4, mRNA. (3173 bp)
misc_feature 200..541 /gene="Ago3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(335..337,422..424,434..436,488..490,509..511, 515..517) /gene="Ago3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 674..1951 /gene="Ago3" /note="PIWI domain,...
XM_045148896.1 - Jaculus jaculus (lesser Egyptian jerboa) - NCBI
PREDICTED: Felis catus argonaute RISC catalytic component 3 (AGO3), transcript variant X8, mRNA. (11711 bp)
misc_feature 1733..2074 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1868..1870,1955..1957,1967..1969,2021..2023, 2042..2044,2048..2050) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 2207..3484 /gene="AGO3" /note="PIWI...
XM_045035543.1 - Felis catus (domestic cat) - NCBI
PREDICTED: Acropora millepora protein argonaute-2-like (LOC114975412), mRNA. (2594 bp)
misc_feature 484..831 /gene="LOC114975412" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(631..633,676..678,721..723,733..735,787..789, 805..807,811..813) /gene="LOC114975412" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1000..2193 /gene="...
XM_029355589.2 - Acropora millepora - NCBI
PREDICTED: Ursus arctos horribilis protein argonaute-4 (LOC113268300), transcript variant X3, mRNA. (2551 bp)
misc_feature 734..1096 /gene="LOC113268300" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(890..892,935..937,977..979,989..991,1043..1045, 1064..1066,1070..1072) /gene="LOC113268300" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1235..2392 /gene...
XM_044390454.1 - Ursus arctos horribilis - NCBI
PREDICTED: Cervus canadensis argonaute RISC component 1 (AGO1), transcript variant X3, mRNA. (6964 bp)
misc_feature 231..383 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 384..746 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(540..542,627..629,639..641,693..695,714..716, 720..722) /gene="AGO1" /note="nucleic acid-binding interface...
XM_043461922.1 - Cervus canadensis - NCBI
PREDICTED: Equus asinus protein argonaute-1 (LOC106830533), transcript variant X4, mRNA. (6946 bp)
misc_feature 232..384 /gene="LOC106830533" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 385..747 /gene="LOC106830533" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(541..543,628..630,640..642,694..696,715..717, 721..723) /gene="LOC106830533" /note="nucleic...
XM_044770337.1 - Equus asinus (ass) - NCBI
PREDICTED: Neovison vison argonaute RISC catalytic component 3 (AGO3), transcript variant X2, mRNA. (4328 bp)
misc_feature 158..442 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:406799" misc_feature 470..622 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:400854" misc_feature 623..985 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_044237793.1 - Neogale vison (American mink) - NCBI
PREDICTED: Echinops telfairi argonaute RISC catalytic component 2 (AGO2), mRNA. (3149 bp)
misc_feature <341..481 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:374571" misc_feature 509..661 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:370073" misc_feature 662..1024 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_004697379.3 - Echinops telfairi (small Madagascar hedgehog) - NCBI
PREDICTED: Mustela putorius furo argonaute RISC catalytic component 3 (AGO3), transcript variant X9, mRNA. (6927 bp)
misc_feature 1379..1720 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1514..1516,1601..1603,1613..1615,1667..1669, 1688..1690,1694..1696) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1853..3130 /gene="AGO3" /note="PIWI...
XM_045064195.1 - Mustela putorius furo (domestic ferret) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/Argonaute+%22PAZ+domain%22
lang : en | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.963 | 0.963 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.980 | 0.016 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
1.328 | 0.348 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
1.336 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]