GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2025-02-21 21:46:58, GGRNA : RefSeq release 228 (Jan, 2025)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. (2346 bp)
LOCUS XM_062931429 2346 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. ACCESSION XM_062931429 VERSION XM_062931429.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062931429.1 - Colletotrichum destructivum - NCBI
Caenorhabditis elegans PAZ domain-containing protein (wago-10), mRNA. (3217 bp)
misc_feature 1097..1375 /gene="wago-10" /locus_tag="CELE_T22H9.3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1178..1180,1223..1225,1256..1258,1268..1270, 1322..1324,1343..1345,1349..1351) /gene="wago-10" /locus_tag="CELE_T22H9.3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /...
NM_070776.5 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. (2979 bp)
LOCUS XM_062919679 2979 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. ACCESSION XM_062919679 VERSION XM_062919679.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062919679.1 - Colletotrichum destructivum - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. (288 bp)
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This...
XM_024651321.1 - Strongyloides ratti - NCBI
Verticillium alfalfae VaMs.102 argonaute partial mRNA. (2883 bp)
misc_feature <400..618 /locus_tag="VDBG_03564" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 649..807 /locus_tag="VDBG_03564" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 913..1248 /locus_tag="VDBG_03564" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_003005565.1 - Verticillium alfalfae VaMs.102 - NCBI
Phytophthora ramorum Protein argonaute-4 (KRP23_1681), partial mRNA. (549 bp)
tag="KRP23_1681" /db_xref="GeneID:94222150" CDS 1..549 /locus_tag="KRP23_1681" /codon_start=1 /product="Protein argonaute-4" /protein_id="XP_067749014.1" /db_xref="GeneID:94222150" /translation="MDAIDFLCETLALRNMSTSVAKYQHSTFSKAIRDVKVNMIHRPGVKRSYRVNGLSRESADNTFFGDDEGQRMSIAQYFQQTYKIRLRYQKLSCLQRNYLPMEVCHVMAGQTCLHNVTDTQVANMIRLTCTPPGDRSSTSSARLTSTRTRSPKASTGCGKAENGGNDGPPAATSCDRVQWRGL" misc_feature 1..318 /locus_tag="KRP23_1681" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_067886343.1 - Phytophthora ramorum (sudden oak death agent) - NCBI
PREDICTED: Channa argus argonaute RISC component 1 (ago1), transcript variant X3, mRNA. (4643 bp)
misc_feature 185..526 /gene="ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(320..322,365..367,407..409,419..421,473..475, 494..496,500..502) /gene="ago1" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 659..1936 /gene="ago1" /note="PIWI...
XM_067511438.1 - Channa argus (northern snakehead) - NCBI
PREDICTED: Sus scrofa argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (16554 bp)
misc_feature 992..1333 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1127..1129,1172..1174,1214..1216,1226..1228, 1280..1282,1301..1303,1307..1309) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1466..2743 /gene="AGO3" /...
XM_021093291.1 - Sus scrofa (pig) - NCBI
PREDICTED: Oryctolagus cuniculus protein argonaute-4 (LOC100357099), transcript variant X4, mRNA. (5822 bp)
misc_feature 180..542 /gene="LOC100357099" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(336..338,381..383,423..425,435..437,489..491, 510..512,516..518) /gene="LOC100357099" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 681..1988 /gene="...
XM_051832166.2 - Oryctolagus cuniculus (rabbit) - NCBI
PREDICTED: Orbicella faveolata protein argonaute-2-like (LOC110055455), transcript variant X2, mRNA. (2015 bp)
misc_feature 112..474 /gene="LOC110055455" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(268..270,313..315,358..360,370..372,424..426, 442..444,448..450) /gene="LOC110055455" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature <610..1545 /gene="...
XM_020761848.1 - Orbicella faveolata - NCBI
PREDICTED: Equus przewalskii argonaute RISC catalytic component 3 (AGO3), transcript variant X6, mRNA. (5229 bp)
misc_feature 138..479 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(273..275,318..320,360..362,372..374,426..428, 447..449,453..455) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 612..1889 /gene="AGO3" /note="PIWI...
XM_008517510.2 - Equus przewalskii (Przewalski's horse) - NCBI
PREDICTED: Odocoileus virginianus argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (15121 bp)
misc_feature 132..473 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(267..269,312..314,354..356,366..368,420..422, 441..443,447..449) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 606..1883 /gene="AGO3" /note="PIWI...
XM_020880240.2 - Odocoileus virginianus (white-tailed deer) - NCBI
PREDICTED: Channa argus argonaute RISC component 4 (ago4), transcript variant X8, mRNA. (2821 bp)
misc_feature 307..696 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 727..879 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 880..1242 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067496209.1 - Channa argus (northern snakehead) - NCBI
PREDICTED: Equus caballus argonaute RISC catalytic component 3 (AGO3), transcript variant X6, mRNA. (5229 bp)
misc_feature 138..479 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(273..275,318..320,360..362,372..374,426..428, 447..449,453..455) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 612..1889 /gene="AGO3" /note="PIWI...
XM_023633498.2 - Equus caballus (horse) - NCBI
PREDICTED: Equus caballus argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (5309 bp)
misc_feature 218..559 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(353..355,398..400,440..442,452..454,506..508, 527..529,533..535) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 692..1969 /gene="AGO3" /note="PIWI...
XM_023633506.2 - Equus caballus (horse) - NCBI
PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X6, mRNA. (5471 bp)
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612515.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI
PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X5, mRNA. (5480 bp)
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612514.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI
PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X4, mRNA. (5503 bp)
misc_feature 275..664 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 695..847 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 848..1210 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612513.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI
PREDICTED: Phalaenopsis equestris protein argonaute MEL1-like (LOC110021703), transcript variant X2, mRNA. (2618 bp)
misc_feature 659..1009 /gene="LOC110021703" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(806..808,851..853,890..892,902..904,956..958, 977..979,983..985) /gene="LOC110021703" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1154..2455 /gene="...
XM_020720298.1 - Phalaenopsis equestris - NCBI
PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X3, mRNA. (5512 bp)
misc_feature 275..664 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 695..847 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 848..1210 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612512.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI
PREDICTED: Phalaenopsis equestris protein argonaute MEL1-like (LOC110021703), transcript variant X1, mRNA. (2624 bp)
misc_feature 659..1009 /gene="LOC110021703" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(806..808,851..853,890..892,902..904,956..958, 977..979,983..985) /gene="LOC110021703" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1154..2461 /gene="...
XM_020720297.1 - Phalaenopsis equestris - NCBI
PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X2, mRNA. (5519 bp)
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612511.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI
PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X1, mRNA. (5528 bp)
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612510.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI
PREDICTED: Rhinolophus sinicus argonaute 3, RISC catalytic component (AGO3), transcript variant X9, mRNA. (5449 bp)
misc_feature 65..406 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(200..202,245..247,287..289,299..301,353..355, 374..376,380..382) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 539..1816 /gene="AGO3" /note="PIWI domain...
XM_019726519.1 - Rhinolophus sinicus (Chinese rufous horseshoe bat) - NCBI
PREDICTED: Asparagus officinalis protein argonaute PNH1 (LOC109826616), mRNA. (2276 bp)
misc_feature 25..369 /gene="LOC109826616" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(172..174,217..219,250..252,262..264,316..318, 337..339,343..345) /gene="LOC109826616" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 502..1854 /gene="...
XM_020393640.1 - Asparagus officinalis (garden asparagus) - NCBI
PREDICTED: Globicephala melas protein argonaute-1 (LOC115860028), transcript variant X4, mRNA. (3533 bp)
misc_feature 193..345 /gene="LOC115860028" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 346..708 /gene="LOC115860028" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(502..504,547..549,589..591,601..603,655..657, 676..678,682..684) /gene="LOC115860028" /note...
XM_030869425.2 - Globicephala melas (long-finned pilot whale) - NCBI
PREDICTED: Heterocephalus glaber argonaute 1, RISC catalytic component (Ago1), transcript variant X3, mRNA. (6900 bp)
misc_feature 260..412 /gene="Ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 413..775 /gene="Ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(569..571,614..616,656..658,668..670,722..724, 743..745,749..751) /gene="Ago1" /note="nucleic acid-binding...
XM_021263314.1 - Heterocephalus glaber (naked mole-rat) - NCBI
PREDICTED: Rhinolophus sinicus argonaute 3, RISC catalytic component (AGO3), transcript variant X8, mRNA. (5506 bp)
misc_feature 122..463 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(257..259,302..304,344..346,356..358,410..412, 431..433,437..439) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 596..1873 /gene="AGO3" /note="PIWI...
XM_019726517.1 - Rhinolophus sinicus (Chinese rufous horseshoe bat) - NCBI
PREDICTED: Rhinolophus sinicus argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (5499 bp)
misc_feature 115..456 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(250..252,295..297,337..339,349..351,403..405, 424..426,430..432) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 589..1866 /gene="AGO3" /note="PIWI...
XM_019726516.1 - Rhinolophus sinicus (Chinese rufous horseshoe bat) - NCBI
PREDICTED: Rhinolophus sinicus argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (5581 bp)
misc_feature 197..538 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(332..334,377..379,419..421,431..433,485..487, 506..508,512..514) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 671..1948 /gene="AGO3" /note="PIWI...
XM_019726515.1 - Rhinolophus sinicus (Chinese rufous horseshoe bat) - NCBI
PREDICTED: Rhinolophus sinicus argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (5576 bp)
misc_feature 192..533 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(327..329,372..374,414..416,426..428,480..482, 501..503,507..509) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 666..1943 /gene="AGO3" /note="PIWI...
XM_019726514.1 - Rhinolophus sinicus (Chinese rufous horseshoe bat) - NCBI
PREDICTED: Gavialis gangeticus protein argonaute-1 (LOC109294022), transcript variant X3, mRNA. (2458 bp)
misc_feature 164..556 /gene="LOC109294022" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 584..736 /gene="LOC109294022" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 737..1099 /gene="LOC109294022" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_019512210.1 - Gavialis gangeticus (Gharial) - NCBI
PREDICTED: Globicephala melas argonaute RISC catalytic component 3 (AGO3), mRNA. (5795 bp)
misc_feature 475..759 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 787..939 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 940..1302 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_030869363.2 - Globicephala melas (long-finned pilot whale) - NCBI
PREDICTED: Pseudorasbora parva argonaute RISC component 4 (ago4), transcript variant X6, mRNA. (3258 bp)
misc_feature 224..613 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 644..796 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 797..1159 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067426678.1 - Pseudorasbora parva (stone moroko) - NCBI
PREDICTED: Pseudorasbora parva argonaute RISC component 4 (ago4), transcript variant X5, mRNA. (3275 bp)
misc_feature 224..613 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 644..796 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 797..1159 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067426677.1 - Pseudorasbora parva (stone moroko) - NCBI
Phytophthora ramorum Protein argonaute PNH1 (KRP23_3271), partial mRNA. (2643 bp)
misc_feature 331..606 /locus_tag="KRP23_3271" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 637..780 /locus_tag="KRP23_3271" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 784..1128 /locus_tag="KRP23_3271" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_067888100.1 - Phytophthora ramorum (sudden oak death agent) - NCBI
PREDICTED: Oryctolagus cuniculus argonaute RISC catalytic component 3 (LOC100356842), transcript variant X11, mRNA. (7314 bp)
misc_feature 153..305 /gene="LOC100356842" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 306..668 /gene="LOC100356842" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(462..464,507..509,549..551,561..563,615..617, 636..638,642..644) /gene="LOC100356842" /note...
XM_051832184.2 - Oryctolagus cuniculus (rabbit) - NCBI
PREDICTED: Pseudorasbora parva argonaute RISC component 4 (ago4), transcript variant X4, mRNA. (3291 bp)
misc_feature 224..613 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 644..796 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 797..1159 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067426676.1 - Pseudorasbora parva (stone moroko) - NCBI
PREDICTED: Oryctolagus cuniculus argonaute RISC catalytic component 3 (LOC100356842), transcript variant X9, mRNA. (7384 bp)
misc_feature 223..375 /gene="LOC100356842" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 376..738 /gene="LOC100356842" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(532..534,577..579,619..621,631..633,685..687, 706..708,712..714) /gene="LOC100356842" /note...
XM_051832182.2 - Oryctolagus cuniculus (rabbit) - NCBI
PREDICTED: Oryctolagus cuniculus argonaute RISC catalytic component 3 (LOC100356842), transcript variant X8, mRNA. (7366 bp)
misc_feature 205..357 /gene="LOC100356842" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 358..720 /gene="LOC100356842" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(514..516,559..561,601..603,613..615,667..669, 688..690,694..696) /gene="LOC100356842" /note...
XM_051832183.2 - Oryctolagus cuniculus (rabbit) - NCBI
PREDICTED: Anolis sagrei protein argonaute-1-like (LOC137095714), transcript variant X4, mRNA. (2622 bp)
misc_feature 254..406 /gene="LOC137095714" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 407..769 /gene="LOC137095714" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(563..565,608..610,650..652,662..664,716..718, 737..739,743..745) /gene="LOC137095714" /note...
XM_067462515.1 - Anolis sagrei (Brown anole) - NCBI
PREDICTED: Alexandromys fortis protein argonaute-4 (LOC126509628), transcript variant X2, mRNA. (5023 bp)
misc_feature 461..850 /gene="LOC126509628" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 881..1033 /gene="LOC126509628" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1034..1396 /gene="LOC126509628" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_050155666.1 - Alexandromys fortis (reed vole) - NCBI
PREDICTED: Crocodylus porosus protein argonaute-1 (LOC109318455), transcript variant X7, mRNA. (2491 bp)
misc_feature 197..589 /gene="LOC109318455" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 617..769 /gene="LOC109318455" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 770..1132 /gene="LOC109318455" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_019547741.1 - Crocodylus porosus (Australian saltwater crocodile) - NCBI
PREDICTED: Alexandromys fortis protein argonaute-1 (LOC126509654), transcript variant X3, mRNA. (7008 bp)
misc_feature 229..381 /gene="LOC126509654" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 382..744 /gene="LOC126509654" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(538..540,583..585,625..627,637..639,691..693, 712..714,718..720) /gene="LOC126509654" /note...
XM_050155694.1 - Alexandromys fortis (reed vole) - NCBI
PREDICTED: Heterocephalus glaber argonaute 3, RISC catalytic component (Ago3), transcript variant X5, mRNA. (9403 bp)
misc_feature 408..770 /gene="Ago3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(564..566,609..611,651..653,663..665,717..719, 738..740,744..746) /gene="Ago3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 903..2180 /gene="Ago3" /note="PIWI...
XM_004850945.2 - Heterocephalus glaber (naked mole-rat) - NCBI
PREDICTED: Pseudorasbora parva argonaute RISC component 4 (ago4), transcript variant X3, mRNA. (3331 bp)
misc_feature 224..613 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 644..796 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 797..1231 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067426675.1 - Pseudorasbora parva (stone moroko) - NCBI
PREDICTED: Numida meleagris argonaute 2, RISC catalytic component (AGO2), transcript variant X5, mRNA. (13718 bp)
misc_feature 268..420 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 421..783 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(577..579,622..624,664..666,676..678,730..732, 751..753,757..759) /gene="AGO2" /note="nucleic acid-binding...
XM_021387141.1 - Numida meleagris (helmeted guineafowl) - NCBI
PREDICTED: Pseudorca crassidens argonaute RISC catalytic component 3 (AGO3), transcript variant X7, mRNA. (15002 bp)
misc_feature 75..416 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(210..212,255..257,297..299,309..311,363..365, 384..386,390..392) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 549..1826 /gene="AGO3" /note="PIWI domain...
XM_067725477.1 - Pseudorca crassidens (false killer whale) - NCBI
PREDICTED: Sus scrofa argonaute 1, RISC catalytic component (AGO1), transcript variant X3, mRNA. (8224 bp)
misc_feature 222..374 /gene="AGO1" /gene_synonym="EIF2C1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 375..737 /gene="AGO1" /gene_synonym="EIF2C1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order...
Synonym: EIF2C1
XM_021093293.1 - Sus scrofa (pig) - NCBI
PREDICTED: Oryctolagus cuniculus argonaute RISC catalytic component 3 (LOC100356842), transcript variant X7, mRNA. (7904 bp)
misc_feature 743..895 /gene="LOC100356842" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 896..1258 /gene="LOC100356842" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1052..1054,1097..1099,1139..1141,1151..1153, 1205..1207,1226..1228,1232..1234) /gene="...
XM_051832181.2 - Oryctolagus cuniculus (rabbit) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/Argonaute+%22PAZ+domain%22
lang : en | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download : 

0.000 | 0.000 | search_start;
0.094 | 0.094 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.110 | 0.016 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.279 | 0.168 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.288 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]