GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2017-06-23 09:07:47, GGRNA : RefSeq release 81 (Mar, 2017)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Neosartorya fischeri NRRL 181 PAZ domain protein (NFIA_024180) partial mRNA. (1410 bp)
misc_feature 109..525 /locus_tag="NFIA_024180" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 559..702 /locus_tag="NFIA_024180" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 754..1104 /locus_tag="NFIA_024180" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_001263935.1 - Aspergillus fischeri NRRL 181 (Neosartorya fischeri NRRL 181) - NCBI
PREDICTED: Diaphorina citri protein argonaute-4-like (LOC103524044), partial mRNA. (231 bp)
alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:103524044" CDS 9..>231 /gene="LOC103524044" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_008487272.1" /db_xref="GeneID:103524044" /translation="MKRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMKLRFPHLPCLQVGQEHKHTYLPLEVSIQRC" misc_feature <9..215 /gene="LOC103524044" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the...
XM_008489050.1 - Diaphorina citri (Asian citrus psyllid) - NCBI
PREDICTED: Danio rerio argonaute RISC catalytic component 3b (ago3b), transcript variant X2, mRNA. (1972 bp)
misc_feature 583..1026 /gene="ago3b" /gene_synonym="ago3; Argonaute3; eif2c3; eif2c3b; sb:eu332; si:dkey-3n22.3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 1057..1206 /gene="ago3b" /gene_synonym="ago3; Argonaute3; eif2c3; eif2c3b; sb:eu332; si:dkey-3n22.3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1207..1569 /gene="ago3b" /gene_synonym="ago3; Argonaute3; eif2c3; eif2c3b; sb:eu332; si:dkey-3n22.3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced...
Synonym: ago3; Argonaute3; eif2c3; eif2c3b; sb:eu332; si:dkey-3n22.3
XM_009294054.2 - Danio rerio (zebrafish) - NCBI - UCSC
Arabidopsis lyrata subsp. lyrata PAZ domain-containing protein, mRNA. (2547 bp)
misc_feature 4..2544 /locus_tag="ARALYDRAFT_326484" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 49..516 /locus_tag="ARALYDRAFT_326484" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 550..699 /locus_tag="ARALYDRAFT_326484" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 748..1092 /locus_tag="ARALYDRAFT_326484" /note="PAZ domain; Region: PAZ; pfam02170" /db_xref="CDD:280352" misc_feature order...
XM_002873982.1 - Arabidopsis lyrata subsp. lyrata - NCBI
Arabidopsis lyrata subsp. lyrata PAZ domain-containing protein, mRNA. (2674 bp)
misc_feature 63..2645 /locus_tag="ARALYDRAFT_902361" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 105..608 /locus_tag="ARALYDRAFT_902361" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 642..788 /locus_tag="ARALYDRAFT_902361" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 837..1178 /locus_tag="ARALYDRAFT_902361" /note="PAZ domain; Region: PAZ; pfam02170" /db_xref="CDD:280352" misc_feature order...
XM_002881208.1 - Arabidopsis lyrata subsp. lyrata - NCBI
Arabidopsis lyrata subsp. lyrata PAZ domain-containing protein, mRNA. (2940 bp)
misc_feature 213..2813 /locus_tag="ARALYDRAFT_489025" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 240..734 /locus_tag="ARALYDRAFT_489025" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 768..917 /locus_tag="ARALYDRAFT_489025" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 978..1307 /locus_tag="ARALYDRAFT_489025" /note="PAZ domain; Region: PAZ; pfam02170" /db_xref="CDD:280352" misc_feature order...
XM_002871925.1 - Arabidopsis lyrata subsp. lyrata - NCBI
Arabidopsis thaliana PAZ domain-containing protein / piwi domain-containing protein mRNA. (2628 bp)
locus_tag="AT5G21030" /gene_synonym="T10F18.3" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 79..549 /locus_tag="AT5G21030" /gene_synonym="T10F18.3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 583..732 /locus_tag="AT5G21030" /gene_synonym="T10F18.3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 781..1125 /locus_tag="AT5G21030" /gene_synonym="T10F18.3" /note="PAZ domain; Region: PAZ; pfam02170" /db_xref="CDD:280352" misc_feature order...
Synonym: T10F18.3
NM_122111.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (3100 bp)
misc_feature 503..844 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="AGO3" /note="Piwi_ago-...
XM_016959144.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (3145 bp)
misc_feature 548..889 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(683..685,728..730,770..772,782..784,836..838, 857..859,863..865) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1022..2299 /gene="AGO3" /note="Piwi_ago-...
XM_016959152.1 - Pan troglodytes (chimpanzee) - NCBI
Danio rerio protein argonaute-3 (LOC567622), mRNA. (3075 bp)
gene="LOC567622" /gene_synonym="ago3a; eif2c1" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 284..727 /gene="LOC567622" /gene_synonym="ago3a; eif2c1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 758..907 /gene="LOC567622" /gene_synonym="ago3a; eif2c1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 908..1270 /gene="LOC567622" /gene_synonym="ago3a; eif2c1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing...
Synonym: ago3a; eif2c1
NM_001302232.1 - Danio rerio (zebrafish) - NCBI - UCSC
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X5, mRNA. (3136 bp)
misc_feature 190..531 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(325..327,370..372,412..414,424..426,478..480, 499..501,505..507) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 664..1941 /gene="...
XM_016974870.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X3, mRNA. (3141 bp)
misc_feature 195..536 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(330..332,375..377,417..419,429..431,483..485, 504..506,510..512) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 669..1946 /gene="...
XM_016974869.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Mus musculus argonaute RISC catalytic subunit 4 (Ago4), transcript variant X4, mRNA. (3265 bp)
misc_feature <508..636 /gene="Ago4" /gene_synonym="5730550L01Rik; AI481660; Eif2c4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature 775..2082 /gene="Ago4" /gene_synonym="5730550L01Rik; AI481660; Eif2c4" /note="Piwi_ago-like: PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-...
Synonym: 5730550L01Rik; AI481660; Eif2c4
XM_006503483.3 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X5, mRNA. (3010 bp)
misc_feature 190..531 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(325..327,370..372,412..414,424..426,478..480, 499..501,505..507) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 664..1941 /gene="...
XM_016967521.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X3, mRNA. (3015 bp)
misc_feature 195..536 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(330..332,375..377,417..419,429..431,483..485, 504..506,510..512) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 669..1946 /gene="...
XM_016967520.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X4, mRNA. (4508 bp)
misc_feature 1562..1903 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1697..1699,1742..1744,1784..1786,1796..1798, 1850..1852,1871..1873,1877..1879) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007641614.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X2, mRNA. (4513 bp)
misc_feature 1567..1908 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1702..1704,1747..1749,1789..1791,1801..1803, 1855..1857,1876..1878,1882..1884) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007641613.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Ornithorhynchus anatinus argonaute 2, RISC catalytic component (AGO2), transcript variant X1, mRNA. (2296 bp)
misc_feature 72..434 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 465..614 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 615..977 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_...
XM_007661244.2 - Ornithorhynchus anatinus (platypus) - NCBI
PREDICTED: Miniopterus natalensis argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (5285 bp)
misc_feature 419..760 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(554..556,599..601,641..643,653..655,707..709, 728..730,734..736) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 893..2170 /gene="AGO3" /note="Piwi_ago-...
XM_016218367.1 - Miniopterus natalensis - NCBI
PREDICTED: Miniopterus natalensis argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (4993 bp)
misc_feature 127..468 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(262..264,307..309,349..351,361..363,415..417, 436..438,442..444) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 601..1878 /gene="AGO3" /note="Piwi_ago-...
XM_016218371.1 - Miniopterus natalensis - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X4, mRNA. (4368 bp)
misc_feature 1548..1889 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1683..1685,1728..1730,1770..1772,1782..1784, 1836..1838,1857..1859,1863..1865) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007618594.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X2, mRNA. (4373 bp)
misc_feature 1553..1894 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1688..1690,1733..1735,1775..1777,1787..1789, 1841..1843,1862..1864,1868..1870) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007618593.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Miniopterus natalensis argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (6091 bp)
misc_feature 1225..1566 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1360..1362,1405..1407,1447..1449,1459..1461, 1513..1515,1534..1536,1540..1542) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1699..2976 /gene="...
XM_016218382.1 - Miniopterus natalensis - NCBI
PREDICTED: Miniopterus natalensis argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (6721 bp)
misc_feature 1855..2196 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1990..1992,2035..2037,2077..2079,2089..2091, 2143..2145,2164..2166,2170..2172) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 2329..3606 /gene="...
XM_016218374.1 - Miniopterus natalensis - NCBI
PREDICTED: Ficedula albicollis argonaute 2, RISC catalytic component (AGO2), transcript variant X3, mRNA. (2994 bp)
misc_feature <70..111 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 112..474 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(268..270,313..315,355..357,367..369,421..423, 442..444,448..450) /gene="AGO2" /note="nucleic acid-binding...
XM_005042516.2 - Ficedula albicollis (collared flycatcher) - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X10, mRNA. (12271 bp)
misc_feature 185..334 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 335..697 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(491..493,536..538,578..580,590..592,644..646, 665..667,671..673) /gene="AGO1" /note="nucleic acid-binding...
XM_009453704.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Rousettus aegyptiacus argonaute 3, RISC catalytic component (AGO3), transcript variant X8, mRNA. (5035 bp)
misc_feature 169..510 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(304..306,349..351,391..393,403..405,457..459, 478..480,484..486) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 643..1920 /gene="AGO3" /note="Piwi_ago-...
XM_016147245.1 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Rousettus aegyptiacus argonaute 3, RISC catalytic component (AGO3), transcript variant X11, mRNA. (5004 bp)
misc_feature 138..479 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(273..275,318..320,360..362,372..374,426..428, 447..449,453..455) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 612..1889 /gene="AGO3" /note="Piwi_ago-...
XM_016147248.1 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Rousettus aegyptiacus argonaute 3, RISC catalytic component (AGO3), transcript variant X10, mRNA. (5040 bp)
misc_feature 174..515 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(309..311,354..356,396..398,408..410,462..464, 483..485,489..491) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 648..1925 /gene="AGO3" /note="Piwi_ago-...
XM_016147247.1 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
Brugia malayi PAZ domain containing protein partial mRNA. (1245 bp)
misc_feature 832..1170 /locus_tag="Bm1_18705" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(979..981,1024..1026,1051..1053,1063..1065, 1117..1119,1138..1140,1144..1146) /locus_tag="Bm1_18705" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" ORIGIN // REFERENCE...
XM_001895163.1 - Brugia malayi - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X9, mRNA. (12367 bp)
misc_feature 281..430 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 431..793 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(587..589,632..634,674..676,686..688,740..742, 761..763,767..769) /gene="AGO1" /note="nucleic acid-binding...
XM_009453699.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Rousettus aegyptiacus argonaute 3, RISC catalytic component (AGO3), transcript variant X9, mRNA. (6345 bp)
misc_feature 1479..1820 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1614..1616,1659..1661,1701..1703,1713..1715, 1767..1769,1788..1790,1794..1796) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1953..3230 /gene="...
XM_016147246.1 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Erinaceus europaeus argonaute 3, RISC catalytic component (AGO3), mRNA. (3135 bp)
misc_feature 258..2702 /gene="AGO3" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 294..737 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 768..917 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 918..1280 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_007533105.2 - Erinaceus europaeus (western European hedgehog) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (3187 bp)
misc_feature <122..388 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 419..568 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 569..931 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_016959129.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Poecilia reticulata protein argonaute-3-like (LOC103473053), mRNA. (2801 bp)
misc_feature 343..2517 /gene="LOC103473053" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 343..786 /gene="LOC103473053" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 817..966 /gene="LOC103473053" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 967..1329 /gene="LOC103473053" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_008422983.2 - Poecilia reticulata (guppy) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (3219 bp)
misc_feature <154..420 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 451..600 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 601..963 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_016959137.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Erinaceus europaeus argonaute 2, RISC catalytic component (AGO2), mRNA. (3444 bp)
misc_feature 118..2553 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 118..477 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 508..657 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 658..1020 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_007532053.1 - Erinaceus europaeus (western European hedgehog) - NCBI
PREDICTED: Pan troglodytes argonaute 4, RISC catalytic component (AGO4), transcript variant X5, mRNA. (7078 bp)
misc_feature <413..676 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 710..859 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 860..1222 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_016959078.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Miniopterus natalensis argonaute 1, RISC catalytic component (AGO1), transcript variant X3, mRNA. (8006 bp)
misc_feature 162..311 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 312..674 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(468..470,513..515,555..557,567..569,621..623, 642..644,648..650) /gene="AGO1" /note="nucleic acid-binding...
XM_016218331.1 - Miniopterus natalensis - NCBI
PREDICTED: Miniopterus natalensis argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (5212 bp)
misc_feature 175..324 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 325..687 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(481..483,526..528,568..570,580..582,634..636, 655..657,661..663) /gene="AGO3" /note="nucleic acid-binding...
XM_016218358.1 - Miniopterus natalensis - NCBI
PREDICTED: Ficedula albicollis argonaute 3, RISC catalytic component (AGO3), mRNA. (4781 bp)
misc_feature 37..2556 /gene="AGO3" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 37..480 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 511..660 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 661..1023 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_016303792.1 - Ficedula albicollis (collared flycatcher) - NCBI
PREDICTED: Cricetulus griseus argonaute 2, RISC catalytic component (Ago2), mRNA. (3443 bp)
misc_feature 140..2575 /gene="Ago2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 140..499 /gene="Ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 530..679 /gene="Ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 680..1042 /gene="Ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_007651571.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-1 (LOC100768807), transcript variant X1, mRNA. (3400 bp)
misc_feature <220..486 /gene="LOC100768807" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 517..666 /gene="LOC100768807" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 667..1029 /gene="LOC100768807" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_016974868.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Erinaceus europaeus argonaute 4, RISC catalytic component (AGO4), mRNA. (2757 bp)
misc_feature <191..454 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 488..637 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 638..1000 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_007533089.2 - Erinaceus europaeus (western European hedgehog) - NCBI
PREDICTED: Rattus norvegicus protein argonaute-4-like (LOC102554576), mRNA. (968 bp)
LOC102554576" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_006227744.1" /db_xref="GeneID:102554576" /db_xref="RGD:7706370" /translation="MEVTLPGEGKDQTFKVSVQWVSVVSLQLLLEALAGHLSEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNGQDDQPVIKRMWITCKTIWEPYMMV" misc_feature 570..719 /gene="LOC102554576" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 720..>902 /gene="LOC102554576" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-...
XM_006227682.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Pan troglodytes argonaute 2, RISC catalytic component (AGO2), transcript variant X3, mRNA. (15409 bp)
misc_feature 1080..3515 /gene="AGO2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 1080..1439 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 1470..1619 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1620..1982 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain...
XM_016959913.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Cricetulus griseus argonaute 2, RISC catalytic component (Ago2), mRNA. (3442 bp)
misc_feature 139..2574 /gene="Ago2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 139..498 /gene="Ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 529..678 /gene="Ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 679..1041 /gene="Ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_007609494.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Monodelphis domestica argonaute 4, RISC catalytic component (AGO4), transcript variant X2, mRNA. (6196 bp)
misc_feature 130..2538 /gene="AGO4" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 139..552 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 586..735 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 736..1098 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_007492794.2 - Monodelphis domestica (gray short-tailed opossum) - NCBI
PREDICTED: Pan troglodytes argonaute 4, RISC catalytic component (AGO4), transcript variant X1, mRNA. (6883 bp)
misc_feature 59..2596 /gene="AGO4" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 68..481 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 515..664 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 665..1027 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_016959062.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Anolis carolinensis protein argonaute-1 (LOC100556413), transcript variant X1, mRNA. (4742 bp)
misc_feature <98..364 /gene="LOC100556413" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 395..544 /gene="LOC100556413" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 545..907 /gene="LOC100556413" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_008120670.2 - Anolis carolinensis (green anole) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/Argonaute+%22PAZ+domain%22
lang : en | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.072 | 0.072 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.086 | 0.014 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.233 | 0.147 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.242 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]