ver.2
Help
|
Advanced search
|
Japanese
Previous release (v1)
2025-07-11 16:01:16, GGRNA : RefSeq release 229 (Mar, 2025)
Summary:
Results:
Matches are highlighted with green background.
Overlapping matches are dark colored.
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This...
XM_024651321.1 -
Strongyloides ratti -
NCBI
LOCUS XM_062931429 2346 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. ACCESSION XM_062931429 VERSION XM_062931429.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062931429.1 -
Colletotrichum destructivum -
NCBI
type_material="culture from type material of Arthrinium hydei" /db_xref="taxon:1337664" /chromosome="Unknown" gene 3150 /locus_tag="PG997_013705" /db_xref="GeneID:92051079" CDS <1..3150 /locus_tag="PG997_013705" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="protein argonaute" /protein_id="XP_066663711.1" /db_xref="GeneID:92051079" /translation="...
XM_066818019.1 -
Apiospora hydei -
NCBI
LOCUS XM_062919679 2979 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. ACCESSION XM_062919679 VERSION XM_062919679.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062919679.1 -
Colletotrichum destructivum -
NCBI
mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3111 /locus_tag="PG985_013254" /db_xref="GeneID:92066081" CDS 1..3111 /locus_tag="PG985_013254" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="eukaryotic translation initiation factor 2c" /protein_id="XP_066677760.1" /db_xref="GeneID:92066081" /...
XM_066833020.1 -
Apiospora marii -
NCBI
marii" /mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3114 /locus_tag="PG985_005260" /db_xref="GeneID:92058090" CDS 1..3114 /locus_tag="PG985_005260" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; N-terminal domain of argonaute; PAZ domain profile.; Piwi domain; Piwi domain profile." /codon_start=1 /product="argonaute" /protein_id="XP_066688189.1" /db_xref="GeneID:92058090" /translation="...
XM_066825029.1 -
Apiospora marii -
NCBI
tag="KRP23_1681" /db_xref="GeneID:94222150" CDS 1..549 /locus_tag="KRP23_1681" /codon_start=1 /product="Protein argonaute-4" /protein_id="XP_067749014.1" /db_xref="GeneID:94222150" /translation="MDAIDFLCETLALRNMSTSVAKYQHSTFSKAIRDVKVNMIHRPGVKRSYRVNGLSRESADNTFFGDDEGQRMSIAQYFQQTYKIRLRYQKLSCLQRNYLPMEVCHVMAGQTCLHNVTDTQVANMIRLTCTPPGDRSSTSSARLTSTRTRSPKASTGCGKAENGGNDGPPAATSCDRVQWRGL" misc_feature 1..318 /locus_tag="KRP23_1681" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_067886343.1 -
Phytophthora ramorum (sudden oak death agent) -
NCBI
type_material="culture from type material of Arthrinium phragmitis" /db_xref="taxon:2905665" /chromosome="Unknown" gene 3012 /locus_tag="PG994_014412" /db_xref="GeneID:92098884" CDS 1..3012 /locus_tag="PG994_014412" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_066708950.1" /db_xref="GeneID:92098884" /translation="...
XM_066865821.1 -
Apiospora phragmitis -
NCBI
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT...
XM_024650915.1 -
Strongyloides ratti -
NCBI
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 -
Strongyloides ratti -
NCBI
aurea" /mol_type="mRNA" /strain="CBS 24483" /culture_collection="CBS:24483" /db_xref="taxon:335848" /chromosome="Unknown" gene 2925 /locus_tag="PG986_006394" /db_xref="GeneID:92075678" CDS 1..2925 /locus_tag="PG986_006394" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; N-terminal domain of argonaute; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="piwi domain-containing protein" /protein_id="XP_066702478.1" /db_xref="GeneID:92075678" /translation="...
XM_066842616.1 -
Apiospora aurea -
NCBI
Apiospora marii" /mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3165 /locus_tag="PG985_001325" /db_xref="GeneID:92054155" CDS 1..3165 /locus_tag="PG985_001325" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; PAZ domain; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="uncharacterized protein" /protein_id="XP_066691973.1" /db_xref="GeneID:92054155" /translation="...
XM_066821094.1 -
Apiospora marii -
NCBI
culture_collection="CBS:114990" /type_material="culture from type material of Arthrinium hydei" /db_xref="taxon:1337664" /chromosome="Unknown" gene 1800 /locus_tag="PG997_013034" /db_xref="GeneID:92050408" CDS 1..1800 /locus_tag="PG997_013034" /note="Argonaute linker 2 domain; consensus disorder prediction; PAZ domain; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="uncharacterized protein" /protein_id="XP_066663040.1" /db_xref="GeneID:92050408" /translation="...
XM_066817348.1 -
Apiospora hydei -
NCBI
misc_feature 185..526 /gene="ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(320..322,365..367,407..409,419..421,473..475, 494..496,500..502) /gene="ago1" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 659..1936 /gene="ago1" /note="PIWI...
XM_067511438.1 -
Channa argus (northern snakehead) -
NCBI
misc_feature 143..484 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(278..280,323..325,365..367,377..379,431..433, 452..454,458..460) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 617..1894 /gene="AGO3" /note="PIWI...
XM_054555331.2 -
Pongo abelii (Sumatran orangutan) -
NCBI
misc_feature 1890..2231 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(2025..2027,2070..2072,2112..2114,2124..2126, 2178..2180,2199..2201,2205..2207) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 2364..3641 /gene="...
XM_054555322.2 -
Pongo abelii (Sumatran orangutan) -
NCBI
misc_feature 508..642 /gene="LOC136922849" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 649..996 /gene="LOC136922849" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(796..798,841..843,886..888,898..900,952..954, 970..972,976..978) /gene="LOC136922849" /note...
XM_067191194.1 -
Acropora muricata -
NCBI
misc_feature 1690..2031 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1825..1827,1870..1872,1912..1914,1924..1926, 1978..1980,1999..2001,2005..2007) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 2164..3441 /gene="...
XM_012439828.2 -
Aotus nancymaae (Ma's night monkey) -
NCBI
misc_feature 247..588 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(382..384,427..429,469..471,481..483,535..537, 556..558,562..564) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 721..1998 /gene="AGO3" /note="PIWI...
XM_018041542.1 -
Capra hircus (goat) -
NCBI
misc_feature 8723..9064 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(8858..8860,8903..8905,8945..8947,8957..8959, 9011..9013,9032..9034,9038..9040) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 9197..10474 /gene="...
XM_055095463.2 -
Pan paniscus (pygmy chimpanzee) -
NCBI
misc_feature 139..480 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,319..321,361..363,373..375,427..429, 448..450,454..456) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO3" /note="PIWI...
XM_063700437.1 -
Gorilla gorilla gorilla (western lowland gorilla) -
NCBI
misc_feature 9217..9558 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(9352..9354,9397..9399,9439..9441,9451..9453, 9505..9507,9526..9528,9532..9534) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 9691..10968 /gene="...
XM_034961271.3 -
Pan paniscus (pygmy chimpanzee) -
NCBI
misc_feature <104..151 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 152..514 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(308..310,353..355,395..397,407..409,461..463, 482..484,488..490) /gene="AGO3" /note="nucleic acid-binding...
XM_018041535.1 -
Capra hircus (goat) -
NCBI
misc_feature 226..378 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 379..741 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(535..537,580..582,622..624,634..636,688..690, 709..711,715..717) /gene="AGO1" /note="nucleic acid-binding...
XM_054555298.2 -
Pongo abelii (Sumatran orangutan) -
NCBI
misc_feature 10969..11310 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(11104..11106,11149..11151,11191..11193,11203..11205, 11257..11259,11278..11280,11284..11286) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_055095460.2 -
Pan paniscus (pygmy chimpanzee) -
NCBI
misc_feature 128..469 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(263..265,308..310,350..352,362..364,416..418, 437..439,443..445) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 602..1879 /gene="AGO3" /note="PIWI...
XM_016959152.4 -
Pan troglodytes (chimpanzee) -
NCBI
misc_feature 277..429 /gene="LOC136763271" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 430..792 /gene="LOC136763271" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(586..588,631..633,673..675,685..687,739..741, 760..762,766..768) /gene="LOC136763271" /note...
XM_066717147.1 -
Amia calva (bowfin) -
NCBI
misc_feature 226..567 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(361..363,406..408,448..450,460..462,514..516, 535..537,541..543) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 700..1977 /gene="AGO3" /note="PIWI...
XM_054665744.2 -
Pan troglodytes (chimpanzee) -
NCBI
misc_feature 228..380 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 381..743 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(537..539,582..584,624..626,636..638,690..692, 711..713,717..719) /gene="AGO1" /note="nucleic acid-binding...
XM_034961260.3 -
Pan paniscus (pygmy chimpanzee) -
NCBI
misc_feature 307..696 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 727..879 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 880..1242 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067496209.1 -
Channa argus (northern snakehead) -
NCBI
misc_feature 280..432 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 433..795 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(589..591,634..636,676..678,688..690,742..744, 763..765,769..771) /gene="AGO1" /note="nucleic acid-binding...
XM_054555295.2 -
Pongo abelii (Sumatran orangutan) -
NCBI
misc_feature 247..399 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 400..762 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(556..558,601..603,643..645,655..657,709..711, 730..732,736..738) /gene="AGO1" /note="nucleic acid-binding...
XM_012439801.2 -
Aotus nancymaae (Ma's night monkey) -
NCBI
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612515.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 517..669 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 670..1032 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(826..828,871..873,913..915,925..927,979..981, 1000..1002,1006..1008) /gene="AGO1" /note="nucleic acid-...
XM_034961257.3 -
Pan paniscus (pygmy chimpanzee) -
NCBI
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612514.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 771..1001 /gene="LOC136807415" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1029..1178 /gene="LOC136807415" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1179..1523 /gene="LOC136807415" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_067063999.1 -
Clytia hemisphaerica -
NCBI
misc_feature 275..664 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 695..847 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 848..1210 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612513.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 275..664 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 695..847 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 848..1210 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612512.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612511.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 269..631 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(425..427,470..472,512..514,524..526,578..580, 599..601,605..607) /gene="AGO2" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 764..2041 /gene="AGO2" /note="PIWI...
XM_065586283.1 -
Chrysemys picta bellii (western painted turtle) -
NCBI
misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067612510.1 -
Thunnus thynnus (Atlantic bluefin tuna) -
NCBI
misc_feature 334..486 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 487..867 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(661..663,706..708,748..750,760..762,814..816, 835..837,841..843) /gene="ago4" /note="nucleic acid-binding...
XM_067255313.1 -
Osmerus mordax (rainbow smelt) -
NCBI
misc_feature 188..529 /gene="LOC129468935" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(323..325,368..370,410..412,422..424,476..478, 497..499,503..505) /gene="LOC129468935" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 662..1939 /gene="...
XM_055254951.2 -
Symphalangus syndactylus (siamang) -
NCBI
mol_type="mRNA" /strain="CBS 24483" /culture_collection="CBS:24483" /db_xref="taxon:335848" /chromosome="Unknown" gene 3018 /locus_tag="PG986_000207" /db_xref="GeneID:92069491" CDS 1..3018 /locus_tag="PG986_000207" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="protein argonaute" /protein_id="XP_066705322.1" /db_xref="GeneID:92069491" /translation="...
XM_066836429.1 -
Apiospora aurea -
NCBI
misc_feature 127..468 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(262..264,307..309,349..351,361..363,415..417, 436..438,442..444) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 601..1878 /gene="AGO3" /note="PIWI...
XM_068539504.1 -
Eschrichtius robustus (grey whale) -
NCBI
misc_feature 143..532 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 563..715 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 716..1078 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_054571963.1 -
Pteronotus mesoamericanus -
NCBI
misc_feature 406..690 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 718..870 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 871..1233 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_068657539.1 -
Anas acuta (northern pintail) -
NCBI
misc_feature 442..726 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 754..906 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 907..1269 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_064471547.1 -
Phalacrocorax carbo (great cormorant) -
NCBI
misc_feature 613..837 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 865..1017 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1018..1380 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_068672721.1 -
Anas acuta (northern pintail) -
NCBI
misc_feature 224..613 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 644..796 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 797..1159 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_067426678.1 -
Pseudorasbora parva (stone moroko) -
NCBI
Data Export:
Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.
Debug Info:
Redirect URI : https://ggrna.dbcls.jp/Argonaute+%22PAZ+domain%22
lang : en |
div : |
spe : |
query_string : Argonaute "PAZ domain" |
format : html |
download :
0.000 | 0.000 | search_start;
1.175 | 1.175 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
1.196 | 0.021 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
1.381 | 0.185 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
1.390 | 0.009 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]