GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:03:34, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       XM_024651321             288 bp    mRNA    linear   INV 10-APR-2018
DEFINITION  Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing
            protein (SRAE_2000048500), partial mRNA.
ACCESSION   XM_024651321
VERSION     XM_024651321.1
DBLINK      BioProject: PRJNA304930
            BioSample: SAMEA1682816
KEYWORDS    RefSeq.
SOURCE      Strongyloides ratti
  ORGANISM  Strongyloides ratti
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Panagrolaimoidea; Strongyloididae; Strongyloides.
REFERENCE   1  (bases 1 to 288)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2
  AUTHORS   Aslett,A.Martin.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-SEP-2014) WTSI, Pathogen Informatics, Wellcome Trust
            Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge
            Cambridgeshire. CB10 1SA, United Kingdom
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_037308).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..288
                     /organism="Strongyloides ratti"
                     /mol_type="mRNA"
                     /strain="ED321 Heterogonic"
                     /db_xref="taxon:34506"
                     /chromosome="2"
     gene            <1..>288
                     /locus_tag="SRAE_2000048500"
                     /db_xref="GeneID:36378174"
     CDS             1..288
                     /locus_tag="SRAE_2000048500"
                     /codon_start=1
                     /product="Argonaute/Dicer protein, PAZ domain-containing
                     protein"
                     /protein_id="XP_024505010.1"
                     /db_xref="GeneID:36378174"
                     /db_xref="InterPro:IPR003100"
                     /db_xref="InterPro:IPR032472"
                     /db_xref="UniProtKB/TrEMBL:A0A090LE87"
                     /translation="
MELLEVANYQRVKPKSQTPDQIRYLIKTCAINPPTRLFGIQRLFKSLQVTNNEFFHYHNLKVQNNPIKVSGRVLESPKIVYANNRYVNTKIDNKS"
     misc_feature    118..243
                     /locus_tag="SRAE_2000048500"
                     /note="Argonaute linker 2 domain; Region: ArgoL2;
                     pfam16488"
                     /db_xref="CDD:318648"
ORIGIN      
atggaacttttagaagttgcaaattatcaaagagttaaaccaaaatctcaaacaccagatcaaataagatatttaataaaaacatgtgctataaatcctcccactagactttttggcatacaacgtttatttaaatctctccaagtaacaaacaatgaattttttcattatcataatttaaaagtacaaaataatccaataaaagtttctggacgtgtattggagtcacctaaaattgtttatgctaataatcgctatgttaatactaaaattgataataaatcatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]