GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2024-05-19 11:49:08, GGRNA : RefSeq release 222 (Jan, 2024)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 25-FEB-2022 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000220.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus highly divergent homeobox (Hdx), transcript variant 2, mRNA. (9213 bp)
LOCUS NM_001395572 9213 bp mRNA linear ROD 20-JUL-2021 DEFINITION Rattus norvegicus highly divergent homeobox (Hdx), transcript variant 2, mRNA. ACCESSION NM_001395572 VERSION NM_001395572.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000430.1....
Synonym: RGD1563666
NM_001395572.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus cut-like homeobox 1, pseudogene 1 (Cux1-ps1), non-coding RNA. (2849 bp)
LOCUS NR_176814 2849 bp RNA linear ROD 12-JUL-2022 DEFINITION Rattus norvegicus cut-like homeobox 1, pseudogene 1 (Cux1-ps1), non-coding RNA. ACCESSION NR_176814 XM_039108675 VERSION NR_176814.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000142.1. On Jul...
NR_176814.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus intestine-specific homeobox (Isx), transcript variant 1, mRNA. (2203 bp)
LOCUS NM_001401000 2203 bp mRNA linear ROD 01-FEB-2022 DEFINITION Rattus norvegicus intestine-specific homeobox (Isx), transcript variant 1, mRNA. ACCESSION NM_001401000 XM_008772332 VERSION NM_001401000.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota;...gene="Isx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1159..1317 /gene="Isx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 1133..1284 /gene="Isx" /inference="alignment:Splign:2.1.0" exon 1285..1360 /gene="...
NM_001401000.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox A2 (Hoxa2), mRNA. (1661 bp)
gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; Hoxa2l; RATHOX111A" /note="homeobox A2" /db_xref="GeneID:103690123" /db_xref="RGD:11468112" exon 1..563 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; Hoxa2l; RATHOX111A" /inference="alignment:Splign:2.1.0" misc_feature 80..82 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; Hoxa2l; RATHOX111A" /note="upstream in-frame stop codon" CDS 185..1303 /gene="Hoxa2" /gene_synonym="hox-1.11; Hoxa-2; Hoxa11; Hoxa2l; RATHOX111A" /note="Homeobox gene A11; Homeobox gene A2; homeobox protein Hox-1.11; homeo box A2" /codon_start=1 /product="...
Synonym: hox-1.11; Hoxa-2; Hoxa11; Hoxa2l; RATHOX111A
NM_012581.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Meis homeobox 3 (Meis3), transcript variant 3, mRNA. (1754 bp)
product="homeobox protein Meis3 isoform 3" /protein_id="NP_001386531.1" /db_xref="GeneID:361514" /db_xref="RGD:1308532" /translation="MARRYEEPRHYPGITEHTAALASFPEAAPSVPRAPGPYGPHRPPQPQGPGLDSDSLKREKDDIYGHPLFPLLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQIRSERPLFSSNPELDNLMVQAIQVLRFHLLELEKGKMPIDLVIEDRDGGCREDLEDYAASCPSLPDQNTTWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQVQWGMCPSPGDGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGYTETQPHVTVRTPGSMGMNLNLEGEWHYL" misc_feature 465..668 /gene="Meis3" /gene_synonym="Mrg2" /note="N-terminal of Homeobox Meis...
Synonym: Mrg2
NM_001399602.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Meis homeobox 3 (Meis3), transcript variant 2, mRNA. (1859 bp)
uct="homeobox protein Meis3 isoform 2" /protein_id="NP_001101942.1" /db_xref="GeneID:361514" /db_xref="RGD:1308532" /translation="MARRYEEPRHYPGITEHTAALASFPEAAPSVPRAPGPYGPHRPPQPQGPGLDSDSLKREKDDIYGHPLFPLLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQIRSERPLFSSNPELDNLMVQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDLEDYAASCPSLPDQNTTWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGYTETQPHVTVRTPGSMGMNLNLEGEWHYL" misc_feature 546..800 /gene="Meis3" /gene_synonym="Mrg2" /note="N-terminal of Homeobox...
Synonym: Mrg2
NM_001108472.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox like (Rhoxl), non-coding RNA. (590 bp)
LOCUS NR_173353 590 bp RNA linear ROD 07-OCT-2023 DEFINITION Rattus norvegicus reproductive homeobox like (Rhoxl), non-coding RNA. ACCESSION NR_173353 XM_017602127 VERSION NR_173353.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000455.1. On Oct...
Synonym: RGD1560927
NR_173353.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus prospero homeobox 2 (Prox2), transcript variant 1, mRNA. (3584 bp)
LOCUS NM_001191771 3584 bp mRNA linear ROD 28-SEP-2022 DEFINITION Rattus norvegicus prospero homeobox 2 (Prox2), transcript variant 1, mRNA. ACCESSION NM_001191771 XM_234418 VERSION NM_001191771.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from...
Synonym: RGD1310315
NM_001191771.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus HOP homeobox (Hopx), mRNA. (1070 bp)
LOCUS NM_133621 1070 bp mRNA linear ROD 06-OCT-2023 DEFINITION Rattus norvegicus HOP homeobox (Hopx), mRNA. ACCESSION NM_133621 VERSION NM_133621.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000252.1. On Nov 25, 2020 this sequence...
Synonym: GIIg15b; Hod; Obl
NM_133621.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box B3 (Hoxb3), mRNA. (1863 bp)
Splign:2.1.0" misc_feature 412..414 /gene="Hoxb3" /note="upstream in-frame stop codon" CDS 466..1755 /gene="Hoxb3" /codon_start=1 /product="homeobox protein Hox-B3" /protein_id="NP_001100512.1" /db_xref="GeneID:303488" /db_xref="RGD:1310780" /translation="...Hoxb3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1036..1194 /gene="Hoxb3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature 1558..1746 /gene="Hoxb3" /note="Domain of unknown function (DUF4074); Region...
NM_001107042.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox A1 (Hoxa1), transcript variant 1, mRNA. (2219 bp)
LOCUS NM_013075 2219 bp mRNA linear ROD 24-NOV-2023 DEFINITION Rattus norvegicus homeobox A1 (Hoxa1), transcript variant 1, mRNA. ACCESSION NM_013075 XM_008762937 XM_008775736 VERSION NM_013075.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus...Hoxa1l" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 792..950 /gene="Hoxa1" /gene_synonym="Hoxa1l" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(798..800,918..920,927..932,939..941) /gene="Hoxa1" /gene_synonym="...
Synonym: Hoxa1l
NM_013075.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus POU class 3 homeobox 3 (Pou3f3), mRNA. (3127 bp)
LOCUS NM_138837 3127 bp mRNA linear ROD 22-NOV-2023 DEFINITION Rattus norvegicus POU class 3 homeobox 3 (Pou3f3), mRNA. ACCESSION NM_138837 VERSION NM_138837.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1282..1443 /gene="Pou3f3" /gene_synonym="Brn1; RHS1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(1282..1284,1291..1293,1411..1413,1420..1425, 1432..1434) /gene="Pou3f3" /...
Synonym: Brn1; RHS1
NM_138837.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus POU class 2 homeobox 1 (Pou2f1), mRNA. (2566 bp)
LOCUS NM_001100639 2566 bp mRNA linear ROD 08-NOV-2023 DEFINITION Rattus norvegicus POU class 2 homeobox 1 (Pou2f1), mRNA. ACCESSION NM_001100639 XM_001075635 XM_341148 VERSION NM_001100639.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota;...gene="Pou2f1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1221..1382 /gene="Pou2f1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(1221..1223,1230..1232,1350..1352,1359..1364, 1371..1373) /gene="Pou2f1" /note="...
NM_001100639.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 8 (Rhox8), mRNA. (738 bp)
LOCUS NM_001025776 738 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus reproductive homeobox 8 (Rhox8), mRNA. ACCESSION NM_001025776 XM_578961 VERSION NM_001025776.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa;...Rhox8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 361..519 /gene="Rhox8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 1..64 /gene="Rhox8" /inference="alignment:Splign:2.1.0" exon 65..440 /gene="Rhox8" /...
NM_001025776.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. (794 bp)
feature 58..60 /gene="Rhox5" /gene_synonym="Pem" /note="upstream in-frame stop codon" exon 94..175 /gene="Rhox5" /gene_synonym="Pem" /inference="alignment:Splign:2.1.0" CDS 97..723 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.2" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="...
Synonym: Pem
NM_022175.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 4G (Rhox4g), mRNA. (829 bp)
LOCUS NM_001024889 829 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus reproductive homeobox 4G (Rhox4g), mRNA. ACCESSION NM_001024889 XM_233314 VERSION NM_001024889.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ058652.1. On Jun...
NM_001024889.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H6 family homeobox 2 (Hmx2), mRNA. (1497 bp)
LOCUS NM_001106303 1497 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus H6 family homeobox 2 (Hmx2), mRNA. ACCESSION NM_001106303 XM_001054069 XM_215056 VERSION NM_001106303.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 546..707 /gene="Hmx2" /gene_synonym="RGD1565366" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(546..548,555..557,675..677,684..689,696..698) /gene="Hmx2" /gene_synonym="...
Synonym: RGD1565366
NM_001106303.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox 10 (Rhox10), mRNA. (714 bp)
LOCUS NM_001037581 714 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus reproductive homeobox 10 (Rhox10), mRNA. ACCESSION NM_001037581 VERSION NM_001037581.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 348..497 /gene="Rhox10" /gene_synonym="Rhoxf10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 419..464 /gene="Rhox10" /gene_synonym="Rhoxf10" /inference="alignment:Splign:2.1.0"...
Synonym: Rhoxf10
NM_001037581.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Rhox homeobox family member 13 (Rhox13), mRNA. (989 bp)
product="reproductive homeobox 13" /protein_id="NP_001395833.1" /db_xref="GeneID:691244" /db_xref="RGD:1586264" /translation="MAQRVSFDHNYYFMECEEETNAGVQARAVASTSTMEASGAMAVAQAGAACRSHASRGTIGYDTVYEPNVKGDPKQESESDTEESYDDEDDDEDEGDEDDLSTSDQDTSDPEQEEAALFVAAAAPPIAPAAAAIQIPGPHRSRRRRHRRHRRSSPYLFTQWQVEEMENLFEETPYPDVLTRGELARTLNVPEVKVKVWFSNRRAKQRKNERRAMLRNMPSGAEDFIFMTDVEEPC" misc_feature order(569..571,689..691,698..703,710..712) /gene="Rhox13" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 572..721 /gene="Rhox13" /note="Homeobox domain; Region: Homeobox...
NM_001408904.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus GS homeobox 1 (Gsx1), mRNA. (1777 bp)
N, Kambe F, Seo H, Oiso Y and Saito H. TITLE Homeobox protein Gsh-1-dependent regulation of the rat GHRH gene promoter JOURNAL Mol Endocrinol 15 (12), 2149-2156 (2001) PUBMED 11731616 REFERENCE 3 (bases 1 to 1777) AUTHORS Li H, Zeitler PS, Valerius MT, Small K and Potter SS. TITLE Gsh-1, an orphan Hox gene, is required for normal pituitary development JOURNAL EMBO J 15 (4), 714-724 (1996) PUBMED 8631293 REFERENCE 4 (bases 1 to 1777) AUTHORS Valerius MT, Li H, Stock JL, Weinstein M, Kaur S, Singh G and Potter SS. TITLE Gsh-1: a novel murine homeobox gene expressed in the central nervous system...
Synonym: Gsh1
NM_001191663.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus PBX homeobox 1 (Pbx1), transcript variant 2, mRNA. (6680 bp)
LOCUS NM_001100681 6680 bp mRNA linear ROD 17-DEC-2023 DEFINITION Rattus norvegicus PBX homeobox 1 (Pbx1), transcript variant 2, mRNA. ACCESSION NM_001100681 XM_001072172 XM_001072218 XM_001072250 VERSION NM_001100681.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was...
NM_001100681.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box C12 (Hoxc12), mRNA. (843 bp)
gene="Hoxc12" /note="homeo box C12" /db_xref="GeneID:300262" /db_xref="RGD:1310539" CDS 1..843 /gene="Hoxc12" /codon_start=1 /product="homeobox protein Hox-C12" /protein_id="NP_001100266.1" /db_xref="GeneID:300262" /db_xref="RGD:1310539" /translation="...gene="Hoxc12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 643..804 /gene="Hoxc12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(643..645,652..654,772..774,781..786,793..795) /gene="Hoxc12" /note="specific DNA base...
NM_001106796.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H6 family homeobox 3 (Hmx3), mRNA. (1362 bp)
note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(688..690,697..699,817..819,826..831,838..840) /gene="Hmx3" /gene_synonym="RGD1559927" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..400 /gene="Hmx3" /gene_synonym="RGD1559927" /inference="alignment:Splign:2.1.0" exon 401..1362 /gene="Hmx3" /gene_synonym="RGD1559927" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 1362) AUTHORS Wang W, Grimmer JF, Van De Water TR and Lufkin T. TITLE Hmx2 and Hmx3 homeobox genes direct development...
Synonym: RGD1559927
NM_001106302.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus brain specific homeobox (Bsx), mRNA. (869 bp)
misc_feature 385..543 /gene="Bsx" /gene_synonym="RGD1565120" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 308..504 /gene="Bsx" /gene_synonym="RGD1565120" /inference="alignment:Splign:2.1.0" exon 505..869 /gene="Bsx" /gene_synonym="RGD1565120" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 869) AUTHORS Carstensen MB, Hertz H, Bering T, Moller M, Rohde K, Klein DC, Coon SL and Rath MF. TITLE Circadian regulation and molecular role of the Bsx homeobox gene in the adult pineal gland JOURNAL J Pineal Res 68 (2), e12629 (2020) PUBMED...
Synonym: RGD1565120
NM_001191995.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus distal-less homeobox 4 (Dlx4), mRNA. (1629 bp)
duct="homeobox protein DLX-4" /protein_id="NP_001100510.1" /db_xref="GeneID:303469" /db_xref="RGD:1308744" /translation="MTSLPCPLPGLGPSNVVFPDLAPASSVVAAYQLGLSPGTAASPDLSFSQTYGHLLSYSYPGPATPGDSYLSSQQQSAAPSRPFHQPTEHPQELEAESEKLALSLEPSQPSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGELEEDFSGRPPSLSPHSLTLPSIWDLPKAGTLPTSGYDNSFGTWYQHHSPDVLALPQRM" misc_feature order(346..360,364..366,415..417,433..435,472..474, 478..483,490..495,499..507,511..516) /gene="Dlx4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 352..513 /gene="Dlx4" /note="Homeobox...
NM_001107040.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus BARX homeobox 1 (Barx1), mRNA. (1372 bp)
LOCUS NM_001108880 1372 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus BARX homeobox 1 (Barx1), mRNA. ACCESSION NM_001108880 XM_001056986 XM_344575 VERSION NM_001108880.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa...gene="Barx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 516..677 /gene="Barx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(516..518,525..527,645..647,654..659,666..668) /gene="Barx1" /note="specific DNA base...
NM_001108880.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox C8 (Hoxc8), mRNA. (1228 bp)
FEATURES Location/Qualifiers source 1..1228 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..1228 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox C8" /db_xref="GeneID:24460" /db_xref="RGD:2821" CDS 1..729 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox protein R4; Homeobox gene C8; homeo box C8" /codon_start=1 /product="homeobox protein Hox-C8" /protein_id="NP_001170797.2" /db_xref="GeneID:24460" /db_xref="RGD:2821" /translation="...
Synonym: Hox3r4
NM_001177326.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ladybird homeobox 2 (Lbx2), mRNA. (816 bp)
LOCUS NM_001109244 816 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus ladybird homeobox 2 (Lbx2), mRNA. ACCESSION NM_001109244 XM_001072452 XM_575575 VERSION NM_001109244.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota;...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 316..477 /gene="Lbx2" /gene_synonym="RGD1561172" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(316..318,325..327,445..447,454..459,466..468) /gene="Lbx2" /gene_synonym="...
Synonym: RGD1561172
NM_001109244.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H2.0-like homeobox (Hlx), mRNA. (2141 bp)
LOCUS NM_001077674 2141 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus H2.0-like homeobox (Hlx), mRNA. ACCESSION NM_001077674 XM_001064868 XM_344184 VERSION NM_001077674.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1148..1309 /gene="Hlx" /gene_synonym="Hlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature 1304..1525 /gene="Hlx" /gene_synonym="Hlx1" /note="propagated from UniProtKB/...
Synonym: Hlx1
NM_001077674.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box C5 (Hoxc5), mRNA. (2734 bp)
Splign:2.1.0" misc_feature 33..35 /gene="Hoxc5" /note="upstream in-frame stop codon" CDS 75..743 /gene="Hoxc5" /codon_start=1 /product="homeobox protein Hox-C5" /protein_id="NP_001101586.1" /db_xref="GeneID:315341" /db_xref="RGD:1307584" /translation="...gene="Hoxc5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 546..707 /gene="Hoxc5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(546..548,555..557,675..677,684..689,696..698) /gene="Hoxc5" /note="specific DNA base...
NM_001108116.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box B8 (Hoxb8), mRNA. (973 bp)
Hox2r1a" /note="homeo box B8" /db_xref="GeneID:24457" /db_xref="RGD:1586211" CDS 1..732 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Hox2.4 homeobox homolog; homeobox gene B8; homeobox protein R1a" /codon_start=1 /product="homeobox protein Hox-B8" /protein_id="NP_001178578.1" /db_xref="GeneID...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 448..606 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 1..424 /gene="Hoxb8" /gene_synonym="Hox2r1a" /inference="alignment:Splign:2.1.0" exon...
Synonym: Hox2r1a
NM_001191649.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H6 family homeobox 1 (Hmx1), mRNA. (1522 bp)
LOCUS NM_001108363 1522 bp mRNA linear ROD 23-MAR-2023 DEFINITION Rattus norvegicus H6 family homeobox 1 (Hmx1), mRNA. ACCESSION NM_001108363 XM_001064149 XM_341238 VERSION NM_001108363.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota;...gene="Hmx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 586..747 /gene="Hmx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(586..588,595..597,715..717,724..729,736..738) /gene="Hmx1" /note="specific DNA base...
NM_001108363.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X1, mRNA. (2580 bp)
LOCUS XM_039103065 2580 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X1, mRNA. ACCESSION XM_039103065 VERSION XM_039103065.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
Synonym: Isl-1; isl-1=homeobox
XM_039103065.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X2, mRNA. (1414 bp)
LOCUS XM_039103066 1414 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus ISL LIM homeobox 1 (Isl1), transcript variant X2, mRNA. ACCESSION XM_039103066 VERSION XM_039103066.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
Synonym: Isl-1; isl-1=homeobox
XM_039103066.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. (1060 bp)
LOCUS NM_017339 1060 bp mRNA linear ROD 18-APR-2023 DEFINITION Rattus norvegicus ISL LIM homeobox 1 (Isl1), mRNA. ACCESSION NM_017339 VERSION NM_017339.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S69329.1. On Apr 28, 2006 this sequence...
Synonym: Isl-1; isl-1=homeobox
NM_017339.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox A7 (Hoxa7), mRNA. (910 bp)
mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="4" /map="4q24" gene 1..910 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /note="homeobox A7" /db_xref="GeneID:500126" /db_xref="RGD:1587253" exon 1..476 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /inference="alignment:Splign:2.1.0" misc_feature 65..67 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /note="upstream in-frame stop codon" CDS 101..790 /gene="Hoxa7" /gene_synonym="Hox1r5; Hoxa9" /note="Homeobox gene A7; hox-1.1; homeobox protein Hox-A7-like; homeobox protein R5; homeobox protein Hox-1.1; homeobox A9" /codon_start=1 /product="...
Synonym: Hox1r5; Hoxa9
NM_001109233.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus T-cell leukemia, homeobox 1 (Tlx1), mRNA. (2000 bp)
LOCUS NM_001109166 2000 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus T-cell leukemia, homeobox 1 (Tlx1), mRNA. ACCESSION NM_001109166 XM_001057997 XM_574674 VERSION NM_001109166.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus...note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 820..981 /gene="Tlx1" /gene_synonym="RGD1563655" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(820..822,829..831,949..951,958..963,970..972) /gene="Tlx1" /gene_synonym="...
Synonym: RGD1563655
NM_001109166.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus PBX homeobox 1 (Pbx1), transcript variant 1, mRNA. (6793 bp)
LOCUS NM_001134862 6793 bp mRNA linear ROD 17-DEC-2023 DEFINITION Rattus norvegicus PBX homeobox 1 (Pbx1), transcript variant 1, mRNA. ACCESSION NM_001134862 XM_222911 VERSION NM_001134862.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from...
NM_001134862.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Rhox homeobox family member 12 (Rhox12), mRNA. (772 bp)
LOCUS NM_001024901 772 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus Rhox homeobox family member 12 (Rhox12), mRNA. ACCESSION NM_001024901 XM_343757 VERSION NM_001024901.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from...
NM_001024901.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus LIM homeobox 6 (Lhx6), mRNA. (3421 bp)
LOCUS NM_001107837 3421 bp mRNA linear ROD 23-MAR-2023 DEFINITION Rattus norvegicus LIM homeobox 6 (Lhx6), mRNA. ACCESSION NM_001107837 XM_001079382 XM_231175 VERSION NM_001107837.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa;...gene="Lhx6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 817..975 /gene="Lhx6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 148..219 /gene="Lhx6" /inference="alignment:Splign:2.1.0" exon 220..402 /gene="...
NM_001107837.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeobox C9 (Hoxc9), mRNA. (920 bp)
LOCUS NM_001100907 920 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus homeobox C9 (Hoxc9), mRNA. ACCESSION NM_001100907 XM_347335 VERSION NM_001100907.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000187.1. On Oct...
Synonym: Hoxc8
NM_001100907.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus ventral anterior homeobox 1 (Vax1), mRNA. (1011 bp)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 214..297 /gene="Vax1" /note="Region: vax upstream domain" misc_feature 298..477 /gene="Vax1" /note="Region: homeobox" misc_feature order(301..315,319..321,370..372,388..390,427..429, 433..438,445..450,454..462,466..471) /gene="Vax1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 307..468 /gene="Vax1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(307..309,316..318,436..438,445..450,457..459) /gene="Vax1" /note="specific DNA base contacts...
NM_022636.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3), mRNA. (908 bp)
LOCUS NM_001135607 908 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus reproductive homeobox on X chromosome 3 (Rhox3), mRNA. ACCESSION NM_001135607 VERSION NM_001135607.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ058651.1. ##Evidence-...
NM_001135607.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus Rhox homeobox family member 11 (Rhox11), mRNA. (864 bp)
LOCUS NM_001024873 864 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus Rhox homeobox family member 11 (Rhox11), mRNA. ACCESSION NM_001024873 XM_233320 VERSION NM_001024873.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from...
NM_001024873.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box D3 (Hoxd3), mRNA. (2527 bp)
Hox4r6" /inference="alignment:Splign:2.1.0" exon 299..922 /gene="Hoxd3" /gene_synonym="Hox4r6" /inference="alignment:Splign:2.1.0" misc_feature 376..378 /gene="Hoxd3" /gene_synonym="Hox4r6" /note="upstream in-frame stop codon" CDS 382..1680 /gene="Hoxd3" /gene_synonym="Hox4r6" /note="homeobox protein R6; Homeobox gene D3" /codon_start=1 /product="homeobox protein Hox-D3" /protein_id="NP_001257967.1" /db_xref="GeneID:288152" /db_xref="RGD:1588601" /translation="...
Synonym: Hox4r6
NM_001271038.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus homeo box C10 (Hoxc10), mRNA. (1870 bp)
gene 1..1870 /gene="Hoxc10" /note="homeo box C10" /db_xref="GeneID:315338" /db_xref="RGD:1307250" CDS 1..1029 /gene="Hoxc10" /note="Hox3.5 homeobox" /codon_start=1 /product="homeobox protein Hox-C10" /protein_id="NP_001295565.1" /db_xref="GeneID:315338" /db_xref="RGD:1307250" /translation="...gene="Hoxc10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 811..972 /gene="Hoxc10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(811..813,820..822,940..942,949..954,961..963) /gene="Hoxc10" /note="specific DNA base...
NM_001308636.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus gastrulation brain homeobox 1 (Gbx1), mRNA. (1831 bp)
LOCUS NM_001271453 1831 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus gastrulation brain homeobox 1 (Gbx1), mRNA. ACCESSION NM_001271453 XM_001063850 VERSION NM_001271453.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota;...gene="Gbx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1362..1523 /gene="Gbx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(1362..1364,1371..1373,1491..1493,1500..1505, 1512..1514) /gene="Gbx1" /note="specific DNA...
NM_001271453.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/en/rn/homeobox
lang : en | div : | spe : rn | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.082 | 0.081 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Rattus norvegicus (Norway rat)?to=0&format=json
0.139 | 0.057 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?source=Rattus norvegicus (Norway rat)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.144 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]