GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 14:18:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001100907             920 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus homeobox C9 (Hoxc9), mRNA.
ACCESSION   NM_001100907 XM_347335
VERSION     NM_001100907.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 920)
  AUTHORS   McIntyre DC, Rakshit S, Yallowitz AR, Loken L, Jeannotte L,
            Capecchi MR and Wellik DM.
  TITLE     Hox patterning of the vertebrate rib cage
  JOURNAL   Development 134 (16), 2981-2989 (2007)
   PUBMED   17626057
REFERENCE   2  (bases 1 to 920)
  AUTHORS   Nauta AJ, Daha MR, Tijsma O, van de Water B, Tedesco F and Roos A.
  TITLE     The membrane attack complex of complement induces caspase
            activation and apoptosis
  JOURNAL   Eur J Immunol 32 (3), 783-792 (2002)
   PUBMED   11870622
  REMARK    GeneRIF: The membrane attack complex of complement induces caspase
            activation and apoptosis.
REFERENCE   3  (bases 1 to 920)
  AUTHORS   Suemori H, Takahashi N and Noguchi S.
  TITLE     Hoxc-9 mutant mice show anterior transformation of the vertebrae
            and malformation of the sternum and ribs
  JOURNAL   Mech Dev 51 (2-3), 265-273 (1995)
   PUBMED   7547473
REFERENCE   4  (bases 1 to 920)
  AUTHORS   Sakoyama Y, Mizuta I, Ogasawara N and Yoshikawa H.
  TITLE     Cloning of rat homeobox genes
  JOURNAL   Biochem Genet 32 (9-10), 351-360 (1994)
   PUBMED   7702549
REFERENCE   5  (bases 1 to 920)
  AUTHORS   Chung SY, Dai PH, Lei J, Riviere M, Levan G, Szpirer J and Szpirer
            C.
  TITLE     Chromosomal assignment of seven rat homeobox genes to rat
            chromosomes 3, 4, 7, and 10
  JOURNAL   Mamm Genome 4 (9), 537-540 (1993)
   PUBMED   7906969
REFERENCE   6  (bases 1 to 920)
  AUTHORS   Falzon M and Chung SY.
  TITLE     The expression of rat homeobox-containing genes is developmentally
            regulated and tissue specific
  JOURNAL   Development 103 (3), 601-610 (1988)
   PUBMED   2907739
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000187.1.
            
            On Oct 21, 2010 this sequence version replaced XM_347335.4.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BQ208027.1, BQ205031.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132263, SAMD00132264
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-538               JACYVU010000187.1  20853316-20853853
            539-920             JACYVU010000187.1  20855615-20855996
FEATURES             Location/Qualifiers
     source          1..920
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="7"
                     /map="7q36"
     gene            1..920
                     /gene="Hoxc9"
                     /gene_synonym="Hoxc8"
                     /note="homeobox C9"
                     /db_xref="GeneID:368178"
                     /db_xref="RGD:1595784"
     CDS             1..783
                     /gene="Hoxc9"
                     /gene_synonym="Hoxc8"
                     /note="homeo box C9"
                     /codon_start=1
                     /product="homeobox protein Hox-C9"
                     /protein_id="NP_001094377.1"
                     /db_xref="GeneID:368178"
                     /db_xref="RGD:1595784"
                     /translation="
MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGDGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS"
     misc_feature    1..537
                     /gene="Hoxc9"
                     /gene_synonym="Hoxc8"
                     /note="Hox9 activation region; Region: Hox9_act;
                     pfam04617"
                     /db_xref="CDD:428038"
     misc_feature    574..723
                     /gene="Hoxc9"
                     /gene_synonym="Hoxc8"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     exon            1..538
                     /gene="Hoxc9"
                     /gene_synonym="Hoxc8"
                     /inference="alignment:Splign:2.1.0"
     exon            539..920
                     /gene="Hoxc9"
                     /gene_synonym="Hoxc8"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgtcggcgacggggcccatcagtaactattacgtggactcgctcatctctcacgacaatgaagacctcctagcgtccaggtttccggccaccggggctcaccctgccgccgccagacccagcggcttggtgccggactgtagcgattttccgtcctgtagcttcgcgcccaagccggctgtattcagcacgtcgtgggcgcccgtgccctcgcagtcgtccgtggtctatcacccttacggcccccagccccacctcggcgccgacacgcgctacatgcggacttggctcgagccgctgtccggcgccgtctccttccccagcttcccagccgggggccgtcactacgccctcaagcccgacgcctaccccgggcgccgcgccgactgcggcccgggcgacggccgcagctacccggactacatgtacggctctcccggggaactgcgcgaccgcgccccgcagacgctgccctcgcccgaggcggacgcgctggccggcagcaagcacaaagaggagaaggccgacctggaccctagcaaccccgtggccaactggatccatgcccgttccacaaggaagaagcgctgcccctacaccaagtaccagacgctggaactggagaaggagtttctcttcaatatgtatttaactagggaccgtcggtacgaggtggcccgtgttctcaatctcactgagcggcaggtcaaaatctggtttcagaaccggaggatgaaaatgaaaaagatgaataaagaaaaaaccgacaaagaacaatcctaaaccctgccccagcctgctgcctcggcacagccaagggaaacacaaaaaccccaccaaaaaatgccccaactcaggcgggagaaagcacgaaaagaaaaggaaagaacaagatagagaaaagcccaacgtcttaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]