GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 16:39:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001399602            1754 bp    mRNA    linear   ROD 12-JAN-2022
DEFINITION  Rattus norvegicus Meis homeobox 3 (Meis3), transcript variant 3,
            mRNA.
ACCESSION   NM_001399602 XM_006228350
VERSION     NM_001399602.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1754)
  AUTHORS   Liu J, Wang Y, Birnbaum MJ and Stoffers DA.
  TITLE     Three-amino-acid-loop-extension homeodomain factor Meis3 regulates
            cell survival via PDK1
  JOURNAL   Proc Natl Acad Sci U S A 107 (47), 20494-20499 (2010)
   PUBMED   21059917
REFERENCE   2  (bases 1 to 1754)
  AUTHORS   Shim S, Kim Y, Shin J, Kim J and Park S.
  TITLE     Regulation of EphA8 gene expression by TALE homeobox transcription
            factors during development of the mesencephalon
  JOURNAL   Mol Cell Biol 27 (5), 1614-1630 (2007)
   PUBMED   17178831
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000033.1.
            
            On Jan 12, 2022 this sequence version replaced XM_006228350.4.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMD00132263,
                              SAMD00132264 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-182               JACYVU010000033.1  739113-739294
            183-364             JACYVU010000033.1  741078-741259
            365-524             JACYVU010000033.1  741398-741557
            525-575             JACYVU010000033.1  741651-741701
            576-626             JACYVU010000033.1  742513-742563
            627-725             JACYVU010000033.1  742768-742866
            726-837             JACYVU010000033.1  745410-745521
            838-1013            JACYVU010000033.1  745629-745804
            1014-1090           JACYVU010000033.1  747142-747218
            1091-1149           JACYVU010000033.1  747389-747447
            1150-1233           JACYVU010000033.1  748014-748097
            1234-1303           JACYVU010000033.1  748617-748686
            1304-1754           JACYVU010000033.1  749195-749645
FEATURES             Location/Qualifiers
     source          1..1754
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q21"
     gene            1..1754
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /note="Meis homeobox 3"
                     /db_xref="GeneID:361514"
                     /db_xref="RGD:1308532"
     exon            1..182
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     CDS             171..1283
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /note="isoform 3 is encoded by transcript variant 3;
                     Meis1, myeloid ecotropic viral integration site 1 homolog
                     3; myeloid ecotropic viral integration site-related gene
                     2; homeobox protein Meis3"
                     /codon_start=1
                     /product="homeobox protein Meis3 isoform 3"
                     /protein_id="NP_001386531.1"
                     /db_xref="GeneID:361514"
                     /db_xref="RGD:1308532"
                     /translation="
MARRYEEPRHYPGITEHTAALASFPEAAPSVPRAPGPYGPHRPPQPQGPGLDSDSLKREKDDIYGHPLFPLLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQIRSERPLFSSNPELDNLMVQAIQVLRFHLLELEKGKMPIDLVIEDRDGGCREDLEDYAASCPSLPDQNTTWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQVQWGMCPSPGDGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGYTETQPHVTVRTPGSMGMNLNLEGEWHYL"
     misc_feature    465..668
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:435375"
     misc_feature    order(945..956,960..962,1020..1022,1038..1040,1077..1079,
                     1083..1088,1095..1100,1104..1112)
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(948..950,957..959,1086..1088,1095..1100,1107..1109)
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    996..1112
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
     exon            183..364
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            365..524
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            525..575
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            576..626
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            627..725
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            726..837
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            838..1013
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            1014..1090
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            1091..1149
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            1150..1233
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            1234..1303
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
     exon            1304..1754
                     /gene="Meis3"
                     /gene_synonym="Mrg2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gtgacacaggccgggcccgtgtgagcccaggagccgccgccaccctcggccgcgatccgcgggtcttggccactcggagaccccggcacccggcggggacctcggggacctccggccgcgatgagccccaggccgtgacctcccgagcccaggacgcgcggcgccggctcatggcccggaggtatgaggagccgcgccactaccccggcattaccgagcacacggcagccctggccagttttccagaggcagcaccttcagtacctcgagctcctgggccctatggcccacaccggccgccccaaccccaaggtccaggcttggacagcgatagcttgaagagagagaaggatgacatctatggacaccccctcttcccactcttggccctggtctttgagaagtgtgagctggctacatgctcgccccgtgatggggcctcggctgggctgggttcacccccaggtggtgacgtctgctcctctgactccttcaatgaggatattgctgcctttgctaagcagatccgctccgagaggccgctgttctcttccaacccggagctggacaacctgatggtccaggccatccaggtactccggttccacctgctggagctggagaaggggaagatgcccatagacctggtgatcgaggatcgggatggtggttgcagggaggaccttgaggactacgcagcctcctgccccagcctcccagaccagaatactacatggatcagagaccatgaggacagtgggtctgtacatttggggaccccaggtccatccagcggaggcctggcctcccagagcggggacaactcaagtgaccaagtccaatggggcatgtgtccttccccaggagatgggctggacaccagcgtggcctctcccagctccgcaggagaggatgaggacctggacctggagcgcagacggaacaagaagagggggatcttccccaaagtggccaccaacatcatgagggcctggttgttccagcatctctcgcacccgtacccctcagaagagcaaaagaaacagctggcccaggacaccgggctcaccattctgcaggtgaacaactggtttattaatgcccggagacggatagtgcagcccatgattgaccagtctaatcgtacagggcagggtgcatctttcaaccctgagggccagtccatggcaggctacacagagactcaaccacatgtgacagtcaggacgccaggatcaatggggatgaatctgaacttagaaggagaatggcattacctatagaggttggggtcaaaaggagggccccagcctctgactatgaccaccagccttgcacctaattggtccctgctggtccctgggcttcaggacttcacctccaaagctcccaccccattcaacgcctacctccctggggcccccagaggcttgaggacccagagcccacttgagggtttctcaagggcaaagacaaagcctcaaggtcctgcacccttcttctgccctcccctttgcccaggacctgagctgagaactgggccaaggtctgaagaagatggtggctggggccccaatccaggacagagaagagactggggttgggcaaggatgggcaaggaaggagggtcagctggatccaatgtttgggagaatccttcatcttcctgctctctgcctctctcacctcccttctctgacattcttctacctttcctttttttaatgataaagtcttaaaagtgcaaatcaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]