GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 19:11:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001191663            1777 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus GS homeobox 1 (Gsx1), mRNA.
ACCESSION   NM_001191663 XM_221885
VERSION     NM_001191663.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1777)
  AUTHORS   Mizuguchi R, Kriks S, Cordes R, Gossler A, Ma Q and Goulding M.
  TITLE     Ascl1 and Gsh1/2 control inhibitory and excitatory cell fate in
            spinal sensory interneurons
  JOURNAL   Nat Neurosci 9 (6), 770-778 (2006)
   PUBMED   16715081
REFERENCE   2  (bases 1 to 1777)
  AUTHORS   Mutsuga N, Iwasaki Y, Morishita M, Nomura A, Yamamori E, Yoshida M,
            Asai M, Ozaki N, Kambe F, Seo H, Oiso Y and Saito H.
  TITLE     Homeobox protein Gsh-1-dependent regulation of the rat GHRH gene
            promoter
  JOURNAL   Mol Endocrinol 15 (12), 2149-2156 (2001)
   PUBMED   11731616
REFERENCE   3  (bases 1 to 1777)
  AUTHORS   Li H, Zeitler PS, Valerius MT, Small K and Potter SS.
  TITLE     Gsh-1, an orphan Hox gene, is required for normal pituitary
            development
  JOURNAL   EMBO J 15 (4), 714-724 (1996)
   PUBMED   8631293
REFERENCE   4  (bases 1 to 1777)
  AUTHORS   Valerius MT, Li H, Stock JL, Weinstein M, Kaur S, Singh G and
            Potter SS.
  TITLE     Gsh-1: a novel murine homeobox gene expressed in the central
            nervous system
  JOURNAL   Dev Dyn 203 (3), 337-351 (1995)
   PUBMED   8589431
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000224.1.
            
            On Oct 27, 2022 this sequence version replaced NM_001191663.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN12840115,
                              SAMN12840131 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-603               JACYVU010000224.1  3848916-3849518     c
            604-1777            JACYVU010000224.1  3847234-3848407     c
FEATURES             Location/Qualifiers
     source          1..1777
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="12"
                     /map="12p11"
     gene            1..1777
                     /gene="Gsx1"
                     /gene_synonym="Gsh1"
                     /note="GS homeobox 1"
                     /db_xref="GeneID:288457"
                     /db_xref="RGD:1310020"
     exon            1..603
                     /gene="Gsx1"
                     /gene_synonym="Gsh1"
                     /inference="alignment:Splign:2.1.0"
     CDS             195..980
                     /gene="Gsx1"
                     /gene_synonym="Gsh1"
                     /note="genomic screened homeo box 1"
                     /codon_start=1
                     /product="GS homeobox 1"
                     /protein_id="NP_001178592.1"
                     /db_xref="GeneID:288457"
                     /db_xref="RGD:1310020"
                     /translation="
MPRSFLVDSLVLREASDKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSVSPGVAHSPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP"
     misc_feature    order(633..647,651..653,702..704,720..722,759..761,
                     765..770,777..782,786..794,798..803)
                     /gene="Gsx1"
                     /gene_synonym="Gsh1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(639..641,648..650,768..770,777..782,789..791)
                     /gene="Gsx1"
                     /gene_synonym="Gsh1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    642..800
                     /gene="Gsx1"
                     /gene_synonym="Gsh1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            604..1777
                     /gene="Gsx1"
                     /gene_synonym="Gsh1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ccagcacctcgcgcgctccgggcggcgcccgcagcagcagccaaggtgattccagccccggcttgagccgcgcgtggagcctcccggacccgggaaactgcgggtggccgcggcagagggaggccactgcagaatccgcagttccctcgggcgccaggggcgggctggcagcaggtggaccgcgcgccggagccatgccgcgctctttcctggtggattcccttgtgctgcgggaagccagcgacaagaaggctccggagggcagcccgccaccgctcttcccctacgcggtccccccgccgcacgcgctccacggcctctcgccgggcgcctgccacgcgcgcaaggccggcttgctgtgcgtgtgtcccctctgtgtcaccgcttcgcagctgcacgggccccccgggccgccggcgctgccgctactcaaggcgtccttccctcccttcggatcgcagtactgccacgcacccctgggccgccagcactctgtgtctcccggagtcgcccacagcccggccgcggctgcagcagctgccgcactctaccagacctcctacccgctgccggatcccagacagtttcactgcatctccgtggacagcagctcgaaccagctgcccagcagtaagaggatgcggacggcgttcaccagcacgcagctcctggagctggagcgcgagttcgcctccaacatgtacctctcccgcctgcggcgcatcgagatcgcgacctatctgaatctgtccgagaagcaggtgaagatctggtttcagaaccgccgggtgaagcacaagaaagaaggcaagggcagtaaccaccgcggcggagctggggcgggggccggcgggggcgcaccgcaaggctgcaagtgctcttcgctctcctcagccaaatgctcagaggatgacgacgaattgcccatgtctccatcttcctccgggaaggatgacagagatctcacagtcactccgtaggtgcgccttttagaggaccattggtccccccccttccccggcccttcccacacttcaaagactggttcttaggctccggctgccaatcaatggatggggagggctttgcggtggtgcacagctctaggcagagctgagaccttagcagagacttgaagcccttgtcactagggcttcagggtgtttaggaggactccaaatggtgaacgctgggtcctcctcccaggacacagcttcttctccccccccaggcacgcaggccggagaacagcgccttgctgaccgccggcgcctcctcgccgctaactctggactggttcaggcttcctctatcccacaaccctctcttcctcggtcaagctgggctttttcactccgctagtggctatttgctttccttttaacattttttcttgttctcactcccccacagccccccccgtggtcgtttatgcaacgcgtttgttacccccccccccacacacacacacactccggaagcctcttccttctgtctgtttgtcccttaaacagggaccaggtcttgctgttcgaagaagtccccttagcagagaggactgtctcaaatggtattgtattgggggaaatgactgtttccaacactctccaccccctttcaaatgaagccgctgtaaacaacctctcccccatcgtccaggtcccgaccccttctggggactgactgactgtgttgttgtatggtctctgtaatgccagaagatatttatttatttatttatgtacaaaattttaaataaacttttttttcttagaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]