GGRNA ver.2 Help | Advanced search | English    旧バージョン

2018-10-20 20:45:22, GGRNA : RefSeq release 90 (Sep, 2018)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. (288 bp)
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated...
XM_024651321.1 - Strongyloides ratti - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain and Protein of unknown function DUF2650 family-containing protein (SRAE_2000036100), partial mRNA. (3513 bp)
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 - Strongyloides ratti - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. (903 bp)
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Panagrolaimoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not...
XM_024650915.1 - Strongyloides ratti - NCBI
Brugia malayi PAZ domain containing protein partial mRNA. (1245 bp)
misc_feature 832..1170 /locus_tag="Bm1_18705" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(979..981,1024..1026,1051..1053,1063..1065, 1117..1119,1138..1140,1144..1146) /locus_tag="Bm1_18705" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" ORIGIN // REFERENCE...
XM_001895163.1 - Brugia malayi - NCBI
Strongyloides ratti Protein argonaute-2 (SRAE_0000056900), partial mRNA. (846 bp)
codon_start=1 /product="Protein argonaute-2" /protein_id="XP_024500654.1" /db_xref="GeneID:36373813" /db_xref="InterPro:IPR003100" /db_xref="UniProtKB/TrEMBL:A0A090KV99" /translation="MNSQLFFLSIVALEKKNVCRFALSKANELSGNFGNDKLFYAYDGVKNLITNHLLNIDEFVIEREKLGIQYKSIFKNGSVRIFFEKTTRYHEIDLSVYASYLIVTQQALNDKNAGGGGYVQLNGEKSLTESSSFLKYENLRIGLGRIIVGSFTENIKFTNIDEPCFVLSINASKNVYYKSELLDKIIKDEIFRRNVPRLLKDFNAEINDSNIKGVHFETVYRKNGDIIKFRHDLHNHSTIDTIIDMKDGSQKSFAEYFQNKFNIQLKYPVWPLFVYKIHVTN" misc_feature 565..828 /locus_tag="SRAE_56900" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced...
XM_024646477.1 - Strongyloides ratti - NCBI
Aspergillus fischeri NRRL 181 PAZ domain protein partial mRNA. (1410 bp)
misc_feature 109..525 /locus_tag="NFIA_024180" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 559..702 /locus_tag="NFIA_024180" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 754..1104 /locus_tag="NFIA_024180" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_001263935.1 - Aspergillus fischeri NRRL 181 (Neosartorya fischeri NRRL 181) - NCBI
PREDICTED: Tetranychus urticae protein argonaute-2-like (LOC107367184), partial mRNA. (1201 bp)
misc_feature 226..687 /gene="LOC107367184" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 868..1200 /gene="LOC107367184" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1021..1023,1066..1068,1102..1104,1114..1116, 1168..1170,1186..1188) /gene="...
XM_015934897.1 - Tetranychus urticae (two-spotted spider mite) - NCBI
Caenorhabditis remanei hypothetical protein (CRE_14480) mRNA, complete cds. (2583 bp)
misc_feature 16..2415 /locus_tag="CRE_14480" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 73..468 /locus_tag="CRE_14480" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 499..651 /locus_tag="CRE_14480" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 652..1014 /locus_tag="CRE_14480" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003107282.1 - Caenorhabditis remanei - NCBI
Caenorhabditis remanei hypothetical protein (CRE_08398) mRNA, complete cds. (2571 bp)
misc_feature 79..2424 /locus_tag="CRE_08398" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 79..477 /locus_tag="CRE_08398" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 508..672 /locus_tag="CRE_08398" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 676..1041 /locus_tag="CRE_08398" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003101857.1 - Caenorhabditis remanei - NCBI
Caenorhabditis remanei hypothetical protein (CRE_09584) mRNA, complete cds. (2709 bp)
misc_feature 73..2559 /locus_tag="CRE_09584" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 157..573 /locus_tag="CRE_09584" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 604..774 /locus_tag="CRE_09584" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 775..1140 /locus_tag="CRE_09584" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003103769.1 - Caenorhabditis remanei - NCBI
Caenorhabditis remanei hypothetical protein (CRE_25241) mRNA, complete cds. (3177 bp)
misc_feature 250..2931 /locus_tag="CRE_25241" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 316..750 /locus_tag="CRE_25241" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 841..963 /locus_tag="CRE_25241" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1174..1506 /locus_tag="CRE_25241" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_003113068.1 - Caenorhabditis remanei - NCBI
PREDICTED: Oryza sativa Japonica Group protein argonaute 17-like (LOC4328436), transcript variant X2, mRNA. (2409 bp)
misc_feature 239..520 /gene="LOC4328436" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature 653..2008 /gene="LOC4328436" /note="Piwi_ago-like: PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-induced silencing complex (RISC) and related complexes. The PIWI domain is the C-terminal...
XM_015768524.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI
PREDICTED: Canis lupus dingo argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (14606 bp)
misc_feature 139..480 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,319..321,361..363,373..375,427..429, 448..450,454..456) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO3" /note="Piwi_ago-...
XM_025419944.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (14644 bp)
misc_feature 177..518 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(312..314,357..359,399..401,411..413,465..467, 486..488,492..494) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 651..1928 /gene="AGO3" /note="Piwi_ago-...
XM_025419943.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (14654 bp)
misc_feature 166..528 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(322..324,367..369,409..411,421..423,475..477, 496..498,502..504) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 661..1938 /gene="AGO3" /note="Piwi_ago-...
XM_025419942.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Bubalus bubalis argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (5161 bp)
misc_feature 139..480 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,319..321,361..363,373..375,427..429, 448..450,454..456) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO3" /note="Piwi_ago-...
XM_025289099.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Bubalus bubalis argonaute 2, RISC catalytic component (AGO2), transcript variant X5, mRNA. (13824 bp)
misc_feature 204..356 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 357..719 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(513..515,558..560,600..602,612..614,666..668, 687..689,693..695) /gene="AGO2" /note="nucleic acid-binding...
XM_025264831.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Alligator sinensis protein argonaute-1 (LOC102373826), transcript variant X7, mRNA. (2271 bp)
misc_feature 233..457 /gene="LOC102373826" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 485..637 /gene="LOC102373826" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 638..1000 /gene="LOC102373826" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025208056.1 - Alligator sinensis (Chinese alligator) - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16204) partial mRNA. (2352 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2352 /gene="AGO16204" /locus_tag="LACBIDRAFT_315429" /db_xref="GeneID:6074035" CDS 1..2352 /gene="AGO16204" /locus_tag="LACBIDRAFT_315429" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001878380.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6074035" /translation="...
XM_001878345.1 - Laccaria bicolor S238N-H82 - NCBI
PREDICTED: Bubalus bubalis argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (5426 bp)
misc_feature 230..382 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 383..745 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(539..541,584..586,626..628,638..640,692..694, 713..715,719..721) /gene="AGO3" /note="nucleic acid-binding...
XM_025289098.1 - Bubalus bubalis (water buffalo) - NCBI
Caenorhabditis remanei CRE-ALG-1 protein (Cre-alg-1) mRNA, complete cds. (3069 bp)
feature 424..2865 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 424..840 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature <1009..1110 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 1111..1476 /gene="Cre-alg-1" /locus_tag="CRE_22331" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing...
XM_003105478.1 - Caenorhabditis remanei - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein partial mRNA. (2898 bp)
Qualifiers source 1..2898 /organism="Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2898 /locus_tag="LACBIDRAFT_295925" /db_xref="GeneID:6085310" CDS 1..2898 /locus_tag="LACBIDRAFT_295925" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001889672.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6085310" /translation="...
XM_001889637.1 - Laccaria bicolor S238N-H82 - NCBI
PREDICTED: Bubalus bubalis argonaute 2, RISC catalytic component (AGO2), transcript variant X4, mRNA. (2888 bp)
misc_feature 726..950 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 978..1130 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 1131..1493 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025264830.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Canis lupus dingo protein argonaute-1 (LOC112642408), transcript variant X5, mRNA. (8193 bp)
misc_feature 222..374 /gene="LOC112642408" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 375..737 /gene="LOC112642408" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(531..533,576..578,618..620,630..632,684..686, 705..707,711..713) /gene="LOC112642408" /note...
XM_025419949.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Alligator sinensis protein argonaute-1 (LOC102373826), transcript variant X5, mRNA. (2406 bp)
misc_feature 233..457 /gene="LOC102373826" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 485..637 /gene="LOC102373826" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 638..1000 /gene="LOC102373826" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025208054.1 - Alligator sinensis (Chinese alligator) - NCBI
PREDICTED: Alligator sinensis protein argonaute-1 (LOC102373826), transcript variant X4, mRNA. (2424 bp)
misc_feature 233..457 /gene="LOC102373826" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 485..637 /gene="LOC102373826" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 638..1000 /gene="LOC102373826" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025208053.1 - Alligator sinensis (Chinese alligator) - NCBI
PREDICTED: Bubalus bubalis protein argonaute-1 (LOC102406024), transcript variant X4, mRNA. (8147 bp)
misc_feature 230..382 /gene="LOC102406024" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 383..745 /gene="LOC102406024" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(539..541,584..586,626..628,638..640,692..694, 713..715,719..721) /gene="LOC102406024" /note...
XM_025289092.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Theropithecus gelada argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (2885 bp)
misc_feature 289..630 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(424..426,469..471,511..513,523..525,577..579, 598..600,604..606) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 763..2040 /gene="AGO3" /note="Piwi_ago-...
XM_025383335.1 - Theropithecus gelada (gelada) - NCBI
PREDICTED: Canis lupus dingo argonaute 2, RISC catalytic component (AGO2), transcript variant X2, mRNA. (14332 bp)
misc_feature 79..303 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 331..483 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 484..846 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_...
XM_025450841.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Theropithecus gelada argonaute 3, RISC catalytic component (AGO3), transcript variant X2, mRNA. (3379 bp)
misc_feature 783..1124 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(918..920,963..965,1005..1007,1017..1019,1071..1073, 1092..1094,1098..1100) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1257..2534 /gene="AGO3" /note...
XM_025383331.1 - Theropithecus gelada (gelada) - NCBI
PREDICTED: Bubalus bubalis argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (5557 bp)
misc_feature 49..333 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 361..513 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 514..876 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_...
XM_025289096.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Canis lupus dingo argonaute 3, RISC catalytic component (AGO3), transcript variant X2, mRNA. (15182 bp)
misc_feature 229..513 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 541..693 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 694..1056 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025419941.1 - Canis lupus dingo (dingo) - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16202) partial mRNA. (2715 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2715 /gene="AGO16202" /locus_tag="LACBIDRAFT_311854" /db_xref="GeneID:6072122" CDS 1..2715 /gene="AGO16202" /locus_tag="LACBIDRAFT_311854" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001876710.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6072122" /translation="...
XM_001876675.1 - Laccaria bicolor S238N-H82 - NCBI
PREDICTED: Bubalus bubalis argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (6357 bp)
misc_feature 849..1133 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 1161..1313 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 1314..1676 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_025289097.1 - Bubalus bubalis (water buffalo) - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16205) partial mRNA. (2766 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2766 /gene="AGO16205" /locus_tag="LACBIDRAFT_311445" /db_xref="GeneID:6072513" CDS 1..2766 /gene="AGO16205" /locus_tag="LACBIDRAFT_311445" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001876972.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6072513" /translation="...
XM_001876937.1 - Laccaria bicolor S238N-H82 - NCBI
PREDICTED: Bubalus bubalis argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (5738 bp)
misc_feature 230..514 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 542..694 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 695..1057 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025289095.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Pelodiscus sinensis argonaute 3, RISC catalytic component (AGO3), transcript variant X2, mRNA. (2965 bp)
misc_feature 243..527 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 555..707 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 708..1070 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025181222.1 - Pelodiscus sinensis (Chinese softshell turtle) - NCBI
PREDICTED: Canis lupus dingo protein argonaute-1 (LOC112642408), transcript variant X6, mRNA. (8425 bp)
misc_feature 211..435 /gene="LOC112642408" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 463..615 /gene="LOC112642408" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 616..978 /gene="LOC112642408" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025419950.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo protein argonaute-1 (LOC112642408), transcript variant X4, mRNA. (8409 bp)
misc_feature 186..410 /gene="LOC112642408" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 438..590 /gene="LOC112642408" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 591..953 /gene="LOC112642408" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025419948.1 - Canis lupus dingo (dingo) - NCBI
Oryctolagus cuniculus argonaute RISC catalytic component 2 (AGO2), mRNA. (3599 bp)
misc_feature 82..2517 /gene="AGO2" /gene_synonym="EIF2C2" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 82..441 /gene="AGO2" /gene_synonym="EIF2C2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 472..621 /gene="AGO2" /gene_synonym="EIF2C2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 622..984 /gene="AGO2" /gene_synonym="EIF2C2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an...
Synonym: EIF2C2
NM_001082710.1 - Oryctolagus cuniculus (rabbit) - NCBI
PREDICTED: Pelodiscus sinensis argonaute 4, RISC catalytic component (AGO4), transcript variant X3, mRNA. (6348 bp)
misc_feature 115..504 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 535..687 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 688..1065 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025181206.1 - Pelodiscus sinensis (Chinese softshell turtle) - NCBI
Laccaria bicolor S238N-H82 argonaute-like protein (AGO16201) partial mRNA. (2886 bp)
Laccaria bicolor S238N-H82" /mol_type="mRNA" /strain="S238N-H82" /db_xref="taxon:486041" gene 2886 /gene="AGO16201" /locus_tag="LACBIDRAFT_317035" /db_xref="GeneID:6074423" CDS 1..2886 /gene="AGO16201" /locus_tag="LACBIDRAFT_317035" /note="A PIWI/PAZ domain containing member of the Argonaute gene family" /codon_start=1 /product="argonaute-like protein" /protein_id="XP_001878739.1" /db_xref="InterPro:IPR003100" /db_xref="InterPro:IPR003165" /db_xref="GeneID:6074423" /translation="...
XM_001878704.1 - Laccaria bicolor S238N-H82 - NCBI
PREDICTED: Canis lupus dingo argonaute 2, RISC catalytic component (AGO2), transcript variant X1, mRNA. (14573 bp)
misc_feature 320..544 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 572..724 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 725..1087 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025450840.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo protein argonaute-1 (LOC112642408), transcript variant X3, mRNA. (8440 bp)
misc_feature 226..450 /gene="LOC112642408" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 478..630 /gene="LOC112642408" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 631..993 /gene="LOC112642408" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025419947.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Canis lupus dingo argonaute 3, RISC catalytic component (AGO3), transcript variant X1, mRNA. (15400 bp)
misc_feature 447..731 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 759..911 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 912..1274 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_025419940.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Python bivittatus protein argonaute-1 (LOC103066542), transcript variant X1, mRNA. (2544 bp)
misc_feature 141..365 /gene="LOC103066542" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 393..545 /gene="LOC103066542" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 546..908 /gene="LOC103066542" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025171171.1 - Python bivittatus (Burmese python) - NCBI
PREDICTED: Canis lupus dingo protein argonaute-1 (LOC112642408), transcript variant X1, mRNA. (8449 bp)
misc_feature 226..450 /gene="LOC112642408" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 478..630 /gene="LOC112642408" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 631..993 /gene="LOC112642408" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_025419945.1 - Canis lupus dingo (dingo) - NCBI
PREDICTED: Bubalus bubalis argonaute 3, RISC catalytic component (AGO3), transcript variant X2, mRNA. (6245 bp)
misc_feature 737..1021 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 1049..1201 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 1202..1564 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_025289094.1 - Bubalus bubalis (water buffalo) - NCBI
PREDICTED: Alligator sinensis argonaute 4, RISC catalytic component (AGO4), transcript variant X1, mRNA. (4590 bp)
misc_feature 159..413 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 444..596 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 597..959 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_025208041.1 - Alligator sinensis (Chinese alligator) - NCBI
PREDICTED: Oryza sativa Japonica Group protein argonaute 17-like (LOC4328436), transcript variant X1, mRNA. (3093 bp)
misc_feature 296..742 /gene="LOC4328436" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 347..2821 /gene="LOC4328436" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 782..922 /gene="LOC4328436" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 923..1204 /gene="LOC4328436" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway...
XM_015768522.2 - Oryza sativa Japonica Group (Japanese rice) - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/Argonaute+%22PAZ+domain%22
lang : ja | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.099 | 0.099 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.125 | 0.027 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.489 | 0.363 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.498 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]