GGRNA ver.2 Help | Advanced search | English    旧バージョン

2017-12-17 14:54:06, GGRNA : RefSeq release 85 (Nov, 2017)




Aspergillus fischeri NRRL 181 PAZ domain protein partial mRNA. (1410 bp)
misc_feature 109..525 /locus_tag="NFIA_024180" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 559..702 /locus_tag="NFIA_024180" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 754..1104 /locus_tag="NFIA_024180" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_001263935.1 - Aspergillus fischeri NRRL 181 (Neosartorya fischeri NRRL 181) - NCBI
PREDICTED: Diaphorina citri protein argonaute-4-like (LOC103524044), partial mRNA. (231 bp)
alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:103524044" CDS 9..>231 /gene="LOC103524044" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_008487272.1" /db_xref="GeneID:103524044" /translation="MKRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMKLRFPHLPCLQVGQEHKHTYLPLEVSIQRC" misc_feature <9..215 /gene="LOC103524044" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the...
XM_008489050.1 - Diaphorina citri (Asian citrus psyllid) - NCBI
Brugia malayi PAZ domain containing protein partial mRNA. (1245 bp)
misc_feature 832..1170 /locus_tag="Bm1_18705" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(979..981,1024..1026,1051..1053,1063..1065, 1117..1119,1138..1140,1144..1146) /locus_tag="Bm1_18705" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" ORIGIN // REFERENCE...
XM_001895163.1 - Brugia malayi - NCBI
PREDICTED: Rattus norvegicus protein argonaute-4-like (LOC102554576), mRNA. (968 bp)
LOC102554576" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_006227744.1" /db_xref="GeneID:102554576" /db_xref="RGD:7706370" /translation="MEVTLPGEGKDQTFKVSVQWVSVVSLQLLLEALAGHLSEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNGQDDQPVIKRMWITCKTIWEPYMMV" misc_feature 570..719 /gene="LOC102554576" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 720..>902 /gene="LOC102554576" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-...
XM_006227682.3 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
PREDICTED: Tetranychus urticae protein argonaute-2-like (LOC107367184), partial mRNA. (1201 bp)
misc_feature 226..687 /gene="LOC107367184" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 868..1200 /gene="LOC107367184" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1021..1023,1066..1068,1102..1104,1114..1116, 1168..1170,1186..1188) /gene="...
XM_015934897.1 - Tetranychus urticae (two-spotted spider mite) - NCBI
PREDICTED: Brassica napus protein argonaute 1-like (LOC106373411), mRNA. (519 bp)
similarity to: 2 Proteins" /db_xref="GeneID:106373411" CDS 1..519 /gene="LOC106373411" /codon_start=1 /product="protein argonaute 1-like" /protein_id="XP_013669039.1" /db_xref="GeneID:106373411" /translation="MGLSLNIDMSSTAFIEALPVTEFVCELLNRDIRSRPLSDADRVKIKKALRGVKVEVTHRGNMRRKYRISGLTAVATRELTFPVDERNTQKSVVEYFYETYGFRIQHTQLPCLQVGNSNRPNYLPMEVCKIVEGQRYSKRLNERQITALLKVTCQRPQEREKDILRVSFVFDF" misc_feature 49..393 /gene="LOC106373411" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_013813585.1 - Brassica napus (rape) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (3100 bp)
misc_feature 503..844 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="AGO3" /note="Piwi_ago-...
XM_016959144.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (3145 bp)
misc_feature 548..889 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(683..685,728..730,770..772,782..784,836..838, 857..859,863..865) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1022..2299 /gene="AGO3" /note="Piwi_ago-...
XM_016959152.1 - Pan troglodytes (chimpanzee) - NCBI
Loa loa PAZ domain-containing protein partial mRNA. (651 bp)
db_xref="GeneID:9952543" CDS 1..>651 /locus_tag="LOAG_15057" /codon_start=1 /product="PAZ domain-containing protein" /protein_id="XP_020300994.1" /db_xref="GeneID:9952543" /translation="MYPNQFGFGERDTPELEEGKYVAVGAAKGVRIVEGPRGFEGGINAALVIDVKKAAFHVDNQCLLEKVECILRRSRVILMRGIDHLSIAILSKALKGLFVRCNYGKNRAFTIGGVSKENARTSKLVSRTGEMSVEKYFEMKYSVKLKYPTLPLIMERCQTKSNFYPMEVLIVCENQRVSKGQQTPSQVQTMIRACATVPSLRLQQTNTLSQAMKLNSS" misc_feature 178..516 /locus_tag="LOAG_15057" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key...
XM_020448890.1 - Loa loa (eye worm) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X5, mRNA. (3136 bp)
misc_feature 190..531 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(325..327,370..372,412..414,424..426,478..480, 499..501,505..507) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 664..1941 /gene="...
XM_016974870.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X3, mRNA. (3141 bp)
misc_feature 195..536 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(330..332,375..377,417..419,429..431,483..485, 504..506,510..512) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 669..1946 /gene="...
XM_016974869.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X5, mRNA. (3010 bp)
misc_feature 190..531 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(325..327,370..372,412..414,424..426,478..480, 499..501,505..507) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 664..1941 /gene="...
XM_016967521.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X3, mRNA. (3015 bp)
misc_feature 195..536 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(330..332,375..377,417..419,429..431,483..485, 504..506,510..512) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 669..1946 /gene="...
XM_016967520.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X4, mRNA. (4508 bp)
misc_feature 1562..1903 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1697..1699,1742..1744,1784..1786,1796..1798, 1850..1852,1871..1873,1877..1879) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007641614.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X2, mRNA. (4513 bp)
misc_feature 1567..1908 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1702..1704,1747..1749,1789..1791,1801..1803, 1855..1857,1876..1878,1882..1884) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007641613.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Ornithorhynchus anatinus argonaute 2, RISC catalytic component (AGO2), transcript variant X1, mRNA. (2296 bp)
misc_feature 72..434 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 465..614 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 615..977 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_...
XM_007661244.2 - Ornithorhynchus anatinus (platypus) - NCBI
PREDICTED: Calidris pugnax protein argonaute-1 (LOC106890550), mRNA. (4616 bp)
CDD:294420" misc_feature order(1552..1554,1564..1566,1600..1611,1618..1620, 1642..1644,1651..1653,1663..1665,1675..1677) /gene="LOC106890550" /note="5' RNA guide strand anchoring site; other site" /db_xref="CDD:239208" misc_feature <1759..1998 /gene="LOC106890550" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature...
XM_014946455.1 - Calidris pugnax (ruff) - NCBI
PREDICTED: Acropora digitifera protein argonaute-2-like (LOC107331491), transcript variant X4, mRNA. (2854 bp)
misc_feature 458..592 /gene="LOC107331491" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 599..946 /gene="LOC107331491" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(746..748,791..793,836..838,848..850,902..904, 920..922,926..928) /gene="LOC107331491" /note...
XM_015896084.1 - Acropora digitifera - NCBI
PREDICTED: Miniopterus natalensis argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (5285 bp)
misc_feature 419..760 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(554..556,599..601,641..643,653..655,707..709, 728..730,734..736) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 893..2170 /gene="AGO3" /note="Piwi_ago-...
XM_016218367.1 - Miniopterus natalensis - NCBI
PREDICTED: Miniopterus natalensis argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (4993 bp)
misc_feature 127..468 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(262..264,307..309,349..351,361..363,415..417, 436..438,442..444) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 601..1878 /gene="AGO3" /note="Piwi_ago-...
XM_016218371.1 - Miniopterus natalensis - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X4, mRNA. (4368 bp)
misc_feature 1548..1889 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1683..1685,1728..1730,1770..1772,1782..1784, 1836..1838,1857..1859,1863..1865) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007618594.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-3 (LOC100769090), transcript variant X2, mRNA. (4373 bp)
misc_feature 1553..1894 /gene="LOC100769090" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1688..1690,1733..1735,1775..1777,1787..1789, 1841..1843,1862..1864,1868..1870) /gene="LOC100769090" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_007618593.2 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Ficedula albicollis argonaute 2, RISC catalytic component (AGO2), transcript variant X3, mRNA. (2994 bp)
misc_feature <70..111 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 112..474 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(268..270,313..315,355..357,367..369,421..423, 442..444,448..450) /gene="AGO2" /note="nucleic acid-binding...
XM_005042516.2 - Ficedula albicollis (collared flycatcher) - NCBI
PREDICTED: Miniopterus natalensis argonaute 3, RISC catalytic component (AGO3), transcript variant X7, mRNA. (6091 bp)
misc_feature 1225..1566 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1360..1362,1405..1407,1447..1449,1459..1461, 1513..1515,1534..1536,1540..1542) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1699..2976 /gene="...
XM_016218382.1 - Miniopterus natalensis - NCBI
PREDICTED: Miniopterus natalensis argonaute 3, RISC catalytic component (AGO3), transcript variant X6, mRNA. (6721 bp)
misc_feature 1855..2196 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1990..1992,2035..2037,2077..2079,2089..2091, 2143..2145,2164..2166,2170..2172) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 2329..3606 /gene="...
XM_016218374.1 - Miniopterus natalensis - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X7, mRNA. (2489 bp)
misc_feature 109..450 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(244..246,289..291,331..333,343..345,397..399, 418..420,424..426) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 583..1860 /gene="...
XM_017501083.1 - Cebus capucinus imitator - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X3, mRNA. (2883 bp)
misc_feature 503..844 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(638..640,683..685,725..727,737..739,791..793, 812..814,818..820) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 977..2254 /gene="...
XM_017501079.1 - Cebus capucinus imitator - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X5, mRNA. (2916 bp)
misc_feature 536..877 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(671..673,716..718,758..760,770..772,824..826, 845..847,851..853) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1010..2287 /gene="...
XM_017501081.1 - Cebus capucinus imitator - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X4, mRNA. (2964 bp)
misc_feature 584..925 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(719..721,764..766,806..808,818..820,872..874, 893..895,899..901) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1058..2335 /gene="...
XM_017501080.1 - Cebus capucinus imitator - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X10, mRNA. (12271 bp)
misc_feature 185..334 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 335..697 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(491..493,536..538,578..580,590..592,644..646, 665..667,671..673) /gene="AGO1" /note="nucleic acid-binding...
XM_009453704.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Cebus capucinus imitator protein argonaute-3 (LOC108284369), transcript variant X6, mRNA. (3030 bp)
misc_feature 650..991 /gene="LOC108284369" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(785..787,830..832,872..874,884..886,938..940, 959..961,965..967) /gene="LOC108284369" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1124..2401 /gene="...
XM_017501082.1 - Cebus capucinus imitator - NCBI
PREDICTED: Python bivittatus argonaute 4, RISC catalytic component (AGO4), mRNA. (6810 bp)
misc_feature 190..444 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 475..627 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 628..990 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_007435169.1 - Python bivittatus (Burmese python) - NCBI
PREDICTED: Rousettus aegyptiacus argonaute 3, RISC catalytic component (AGO3), transcript variant X8, mRNA. (5035 bp)
misc_feature 169..510 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(304..306,349..351,391..393,403..405,457..459, 478..480,484..486) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 643..1920 /gene="AGO3" /note="Piwi_ago-...
XM_016147245.1 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Rousettus aegyptiacus argonaute 3, RISC catalytic component (AGO3), transcript variant X11, mRNA. (5004 bp)
misc_feature 138..479 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(273..275,318..320,360..362,372..374,426..428, 447..449,453..455) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 612..1889 /gene="AGO3" /note="Piwi_ago-...
XM_016147248.1 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Rousettus aegyptiacus argonaute 3, RISC catalytic component (AGO3), transcript variant X10, mRNA. (5040 bp)
misc_feature 174..515 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(309..311,354..356,396..398,408..410,462..464, 483..485,489..491) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 648..1925 /gene="AGO3" /note="Piwi_ago-...
XM_016147247.1 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Pan troglodytes argonaute 1, RISC catalytic component (AGO1), transcript variant X9, mRNA. (12367 bp)
misc_feature 281..430 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 431..793 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(587..589,632..634,674..676,686..688,740..742, 761..763,767..769) /gene="AGO1" /note="nucleic acid-binding...
XM_009453699.2 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Acropora digitifera protein argonaute-2-like (LOC107331491), transcript variant X3, mRNA. (3294 bp)
misc_feature 1057..1395 /gene="LOC107331491" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1189..1191,1234..1236,1279..1281,1291..1293, 1345..1347,1363..1365,1369..1371) /gene="LOC107331491" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_015896083.1 - Acropora digitifera - NCBI
PREDICTED: Rousettus aegyptiacus argonaute 3, RISC catalytic component (AGO3), transcript variant X9, mRNA. (6345 bp)
misc_feature 1479..1820 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1614..1616,1659..1661,1701..1703,1713..1715, 1767..1769,1788..1790,1794..1796) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1953..3230 /gene="...
XM_016147246.1 - Rousettus aegyptiacus (Egyptian rousette) - NCBI
PREDICTED: Erinaceus europaeus argonaute 3, RISC catalytic component (AGO3), mRNA. (3135 bp)
misc_feature 258..2702 /gene="AGO3" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 294..737 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 768..917 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 918..1280 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_007533105.2 - Erinaceus europaeus (western European hedgehog) - NCBI
PREDICTED: Erinaceus europaeus argonaute 2, RISC catalytic component (AGO2), mRNA. (3444 bp)
misc_feature 253..477 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 505..657 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 658..1020 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_007532053.1 - Erinaceus europaeus (western European hedgehog) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (3187 bp)
misc_feature 104..388 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 416..568 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 569..931 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_016959129.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Poecilia reticulata protein argonaute-3-like (LOC103473053), mRNA. (2801 bp)
misc_feature 343..2517 /gene="LOC103473053" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 343..786 /gene="LOC103473053" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 817..966 /gene="LOC103473053" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 967..1329 /gene="LOC103473053" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_008422983.2 - Poecilia reticulata (guppy) - NCBI
PREDICTED: Pan troglodytes argonaute 3, RISC catalytic component (AGO3), transcript variant X5, mRNA. (3219 bp)
misc_feature 136..420 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 448..600 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 601..963 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_016959137.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Acropora digitifera protein argonaute-2-like (LOC107331491), transcript variant X1, mRNA. (3338 bp)
misc_feature 1102..1440 /gene="LOC107331491" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1234..1236,1279..1281,1324..1326,1336..1338, 1390..1392,1408..1410,1414..1416) /gene="LOC107331491" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...
XM_015896081.1 - Acropora digitifera - NCBI
PREDICTED: Peromyscus maniculatus bairdii protein argonaute-4 (LOC102922378), mRNA. (2208 bp)
misc_feature 52..465 /gene="LOC102922378" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 499..648 /gene="LOC102922378" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 649..1011 /gene="LOC102922378" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_015998639.1 - Peromyscus maniculatus bairdii (prairie deer mouse) - NCBI
PREDICTED: Peromyscus maniculatus bairdii argonaute 1, RISC catalytic component (Ago1), transcript variant X3, mRNA. (6950 bp)
misc_feature 204..356 /gene="Ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 357..719 /gene="Ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(513..515,558..560,600..602,612..614,666..668, 687..689,693..695) /gene="Ago1" /note="nucleic acid-binding...
XM_015998658.1 - Peromyscus maniculatus bairdii (prairie deer mouse) - NCBI
PREDICTED: Cricetulus griseus protein argonaute-4 (LOC100762217), mRNA. (3772 bp)
misc_feature 209..463 /gene="LOC100762217" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 494..646 /gene="LOC100762217" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 647..1009 /gene="LOC100762217" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_016974867.1 - Cricetulus griseus (Chinese hamster) - NCBI
PREDICTED: Pan troglodytes argonaute 4, RISC catalytic component (AGO4), transcript variant X5, mRNA. (7078 bp)
misc_feature 422..676 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:318646" misc_feature 707..859 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 860..1222 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_016959078.1 - Pan troglodytes (chimpanzee) - NCBI
PREDICTED: Peromyscus maniculatus bairdii argonaute 1, RISC catalytic component (Ago1), transcript variant X4, mRNA. (7107 bp)
misc_feature 370..522 /gene="Ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:312283" misc_feature 523..885 /gene="Ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(679..681,724..726,766..768,778..780,832..834, 853..855,859..861) /gene="Ago1" /note="nucleic acid-binding...
XM_015998659.1 - Peromyscus maniculatus bairdii (prairie deer mouse) - NCBI
PREDICTED: Peromyscus maniculatus bairdii argonaute 3, RISC catalytic component (Ago3), mRNA. (4038 bp)
misc_feature 108..2471 /gene="Ago3" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 108..530 /gene="Ago3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 561..710 /gene="Ago3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 711..1073 /gene="Ago3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_015998638.1 - Peromyscus maniculatus bairdii (prairie deer mouse) - NCBI

Data Export:


Debug Info:

Redirect URI :
lang : ja | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.098 | 0.098 | count_done;*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.125 | 0.027 | count_done;*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.298 | 0.173 | search_done;*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.307 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]