GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2026-08-05 20:19:26, GGRNA : RefSeq release 233 (Jan, 2026)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. (288 bp)
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This...
XM_024651321.1 - Strongyloides ratti - NCBI
Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. (2979 bp)
misc_feature 463..708 /locus_tag="CDEST_03520" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 736..909 /locus_tag="CDEST_03520" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1024..1398 /locus_tag="CDEST_03520" /note="PAZ domain; Region: PAZ; pfam02170" /db_xref="CDD:460472" misc_feature 1477..2781 /locus_tag="CDEST_03520" /note="PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-induced silencing complex (RISC) and related complexes. The PIWI domain is the C-...
XM_062919679.1 - Colletotrichum destructivum - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. (903 bp)
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT...
XM_024650915.1 - Strongyloides ratti - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain and Protein of unknown function DUF2650 family-containing protein (SRAE_2000036100), partial mRNA. (3513 bp)
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 - Strongyloides ratti - NCBI
Caenorhabditis elegans PAZ domain-containing protein (wago-10), mRNA. (3217 bp)
misc_feature 1097..1375 /gene="wago-10" /locus_tag="CELE_T22H9.3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1178..1180,1223..1225,1256..1258,1268..1270, 1322..1324,1343..1345,1349..1351) /gene="wago-10" /locus_tag="CELE_T22H9.3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /...
NM_070776.5 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. (2346 bp)
LOCUS XM_062931429 2346 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. ACCESSION XM_062931429 VERSION XM_062931429.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062931429.1 - Colletotrichum destructivum - NCBI
Aspergillus puulaauensis argonaute/piwi family protein (APUU_60047A), partial mRNA. (3000 bp)
misc_feature 424..723 /locus_tag="APUU_60047A" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 763..915 /locus_tag="APUU_60047A" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 919..1383 /locus_tag="APUU_60047A" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_041706848.1 - Aspergillus puulaauensis - NCBI
PREDICTED: Saccoglossus kowalevskii protein argonaute-2-like (LOC144359645), partial mRNA. (496 bp)
with support for all annotated introns" /db_xref="GeneID:144359645" CDS <1..407 /gene="LOC144359645" /codon_start=3 /product="protein argonaute-2-like" /protein_id="XP_077868885.1" /db_xref="GeneID:144359645" /translation="SATAFYKSQSVIDFLCEVLDFRDINEQRRPLTDSQRVKFTKEIKGLKVEITHCGTMRRKYRVCNVTRRPAQTQTFPLQLESGQTVECTVAKYFKDRHKLNLQYPYLPCLQVGQEQKHTYLPLEVSIVFYSLVVL" misc_feature 24..374 /gene="LOC144359645" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ...
XM_078012759.1 - Saccoglossus kowalevskii - NCBI
PREDICTED: Zootermopsis nevadensis protein argonaute-1-like (LOC110838885), mRNA. (819 bp)
samples with support for all annotated introns" /db_xref="GeneID:110838885" CDS 82..414 /gene="LOC110838885" /codon_start=1 /product="protein argonaute-1-like" /protein_id="XP_021938223.1" /db_xref="GeneID:110838885" /translation="MEICNLSSEDLHRELSKERKRDFMNYILGLNVDYMLPNVPTSKRTCKVNRVVENAVKQMFELDSGRSISVAEYIAQEKKIRLSYPHLLCLHVGSLNRCSPIYAPAEVSKA" misc_feature <238..402 /gene="LOC110838885" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_022082531.1 - Zootermopsis nevadensis - NCBI
PREDICTED: Lycorma delicatula protein argonaute-1-like (LOC142328057), transcript variant X3, mRNA. (719 bp)
CDS 72..611 /gene="LOC142328057" /codon_start=1 /product="protein argonaute-1-like isoform X2" /protein_id="XP_075227639.1" /db_xref="GeneID:142328057" /translation="MFYSGYRFVAVGRSFFTPPQQEQIVDLGDGLELRYGFYQSAILGWKPFLNVDVAHKGFSKPENLIKVIRDQNATIGDRVFDKELDNWQKESLQKYIGGLKVEYEIPNQPDSKRTYKVNRVLGSSINQRFDLVEKVGDAQRTKNISVGQYLHQYKNFRLRYPNMPCLHVGPSQRNIFVPY" misc_feature 99..245 /gene="LOC142328057" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 258..605 /gene="LOC142328057" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced...
XM_075371524.1 - Lycorma delicatula (spotted lanternfly) - NCBI
Geosmithia morbida PAZ domain (GMORB2_2890), partial mRNA. (3108 bp)
misc_feature 490..732 /locus_tag="GMORB2_2890" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 772..921 /locus_tag="GMORB2_2890" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 925..1464 /locus_tag="GMORB2_2890" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_035464866.1 - Geosmithia morbida - NCBI
PREDICTED: Pteropus medius argonaute RISC catalytic component 3 (AGO3), transcript variant X9, mRNA. (2353 bp)
misc_feature 137..478 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(272..274,317..319,359..361,371..373,425..427, 446..448,452..454) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 611..1888 /gene="AGO3" /note="PIWI...
XM_039851028.1 - Pteropus medius (Indian flying fox) - NCBI
PREDICTED: Pteropus medius argonaute RISC catalytic component 3 (AGO3), transcript variant X8, mRNA. (2400 bp)
misc_feature 184..525 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(319..321,364..366,406..408,418..420,472..474, 493..495,499..501) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 658..1935 /gene="AGO3" /note="PIWI...
XM_039851027.1 - Pteropus medius (Indian flying fox) - NCBI
PREDICTED: Pteropus medius argonaute RISC catalytic component 3 (AGO3), transcript variant X7, mRNA. (2403 bp)
misc_feature 187..528 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(322..324,367..369,409..411,421..423,475..477, 496..498,502..504) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 661..1938 /gene="AGO3" /note="PIWI...
XM_039851026.1 - Pteropus medius (Indian flying fox) - NCBI
PREDICTED: Canis aureus argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (14993 bp)
misc_feature 139..480 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,319..321,361..363,373..375,427..429, 448..450,454..456) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO3" /note="PIWI...
XM_077844781.1 - Canis aureus (golden jackal) - NCBI
PREDICTED: Canis aureus argonaute RISC catalytic component 3 (AGO3), transcript variant X4, mRNA. (15053 bp)
misc_feature 199..540 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(334..336,379..381,421..423,433..435,487..489, 508..510,514..516) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 673..1950 /gene="AGO3" /note="PIWI...
XM_077844780.1 - Canis aureus (golden jackal) - NCBI
PREDICTED: Macaca mulatta argonaute RISC catalytic component 3 (AGO3), transcript variant X9, mRNA. (3159 bp)
misc_feature 181..522 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(316..318,361..363,403..405,415..417,469..471, 490..492,496..498) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 655..1932 /gene="AGO3" /note="PIWI...
XM_077963824.1 - Macaca mulatta (Rhesus monkey) - NCBI
PREDICTED: Macaca mulatta argonaute RISC catalytic component 3 (AGO3), transcript variant X8, mRNA. (3250 bp)
misc_feature 272..613 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(407..409,452..454,494..496,506..508,560..562, 581..583,587..589) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 746..2023 /gene="AGO3" /note="PIWI...
XM_077963817.1 - Macaca mulatta (Rhesus monkey) - NCBI
PREDICTED: Macaca mulatta argonaute RISC catalytic component 3 (AGO3), transcript variant X7, mRNA. (3298 bp)
misc_feature 320..661 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(455..457,500..502,542..544,554..556,608..610, 629..631,635..637) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 794..2071 /gene="AGO3" /note="PIWI...
XM_077963806.1 - Macaca mulatta (Rhesus monkey) - NCBI
PREDICTED: Canis aureus argonaute RISC catalytic component 3 (AGO3), transcript variant X3, mRNA. (15048 bp)
misc_feature 173..535 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(329..331,374..376,416..418,428..430,482..484, 503..505,509..511) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 668..1945 /gene="AGO3" /note="PIWI...
XM_077844779.1 - Canis aureus (golden jackal) - NCBI
PREDICTED: Paroedura picta protein argonaute-1 (LOC143837570), transcript variant X5, mRNA. (6794 bp)
misc_feature 192..533 /gene="LOC143837570" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(327..329,372..374,414..416,426..428,480..482, 501..503,507..509) /gene="LOC143837570" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 666..1943 /gene="...
XM_077337559.1 - Paroedura picta - NCBI
PREDICTED: Calonectris borealis argonaute RISC component 4 (AGO4), transcript variant X4, mRNA. (2514 bp)
misc_feature 199..588 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 619..771 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 772..1134 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_075173164.1 - Calonectris borealis (Cory's shearwater) - NCBI
PREDICTED: Chanos chanos argonaute RISC catalytic component 3b (ago3b), mRNA. (2831 bp)
misc_feature 290..574 /gene="ago3b" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 602..754 /gene="ago3b" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 755..1117 /gene="ago3b" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_030788702.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Halichoerus grypus argonaute RISC catalytic component 3 (AGO3), transcript variant X3, mRNA. (15265 bp)
misc_feature 185..526 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(320..322,365..367,407..409,419..421,473..475, 494..496,500..502) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 659..1936 /gene="AGO3" /note="PIWI...
XM_078073419.1 - Halichoerus grypus (gray seal) - NCBI
PREDICTED: Amia ocellicauda protein argonaute-1 (LOC136763271), transcript variant X2, mRNA. (3235 bp)
misc_feature 277..429 /gene="LOC136763271" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 430..792 /gene="LOC136763271" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(586..588,631..633,673..675,685..687,739..741, 760..762,766..768) /gene="LOC136763271" /note...
XM_066717147.1 - Amia ocellicauda - NCBI
PREDICTED: Canis aureus argonaute RISC component 1 (AGO1), transcript variant X6, mRNA. (6997 bp)
misc_feature 227..379 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 380..742 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(536..538,581..583,623..625,635..637,689..691, 710..712,716..718) /gene="AGO1" /note="nucleic acid-binding...
XM_077844776.1 - Canis aureus (golden jackal) - NCBI
PREDICTED: Amblyomma americanum protein argonaute-2-like (LOC144100127), mRNA. (2156 bp)
misc_feature 148..498 /gene="LOC144100127" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(310..312,355..357,382..384,394..396,445..447, 466..468,472..474) /gene="LOC144100127" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 631..1920 /gene="...
XM_077633161.1 - Amblyomma americanum (Lone Star tick) - NCBI
PREDICTED: Mustelus asterias argonaute RISC catalytic component 2 (ago2), transcript variant X2, mRNA. (5942 bp)
misc_feature <201..341 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 369..521 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 522..884 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_078215734.1 - Mustelus asterias (starry smooth-hound) - NCBI
PREDICTED: Chanos chanos argonaute RISC catalytic component 2 (ago2), transcript variant X2, mRNA. (2890 bp)
misc_feature 426..650 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 678..830 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 831..1193 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_030788641.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Chanos chanos argonaute RISC component 4 (ago4), transcript variant X2, mRNA. (2592 bp)
misc_feature 82..471 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 502..654 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 655..1017 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_030788751.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Chanos chanos argonaute RISC component 4 (ago4), transcript variant X1, mRNA. (2625 bp)
misc_feature 82..471 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 502..654 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 655..1017 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_030788750.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Stylophora pistillata protein argonaute-2-like (LOC111346866), mRNA. (2488 bp)
misc_feature 239..469 /gene="LOC111346866" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 497..649 /gene="LOC111346866" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature <731..1012 /gene="LOC111346866" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_022954129.1 - Stylophora pistillata - NCBI
PREDICTED: Calonectris borealis argonaute RISC catalytic component 3 (AGO3), transcript variant X4, mRNA. (13574 bp)
misc_feature <181..228 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 229..591 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(385..387,430..432,472..474,484..486,538..540, 559..561,565..567) /gene="AGO3" /note="nucleic acid-binding...
XM_075173154.1 - Calonectris borealis (Cory's shearwater) - NCBI
PREDICTED: Tamandua tetradactyla argonaute RISC catalytic component 3 (AGO3), transcript variant X7, mRNA. (15497 bp)
misc_feature 138..479 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(273..275,318..320,360..362,372..374,426..428, 447..449,453..455) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 612..1889 /gene="AGO3" /note="PIWI...
XM_077150311.1 - Tamandua tetradactyla (southern tamandua) - NCBI
PREDICTED: Pteropus medius protein argonaute-1 (LOC120593270), transcript variant X6, mRNA. (8199 bp)
misc_feature 233..385 /gene="LOC120593270" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 386..748 /gene="LOC120593270" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(542..544,587..589,629..631,641..643,695..697, 716..718,722..724) /gene="LOC120593270" /note...
XM_039851019.1 - Pteropus medius (Indian flying fox) - NCBI
PREDICTED: Tamandua tetradactyla argonaute RISC catalytic component 3 (AGO3), transcript variant X8, mRNA. (18290 bp)
misc_feature 2931..3272 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(3066..3068,3111..3113,3153..3155,3165..3167, 3219..3221,3240..3242,3246..3248) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 3405..4682 /gene="...
XM_077150312.1 - Tamandua tetradactyla (southern tamandua) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X7, mRNA. (6349 bp)
misc_feature 265..651 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 682..834 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 835..1197 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735679.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X9, mRNA. (6346 bp)
misc_feature 277..663 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 694..846 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 847..1227 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735682.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X8, mRNA. (6345 bp)
misc_feature 276..662 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 693..845 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 846..1208 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735680.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X6, mRNA. (6360 bp)
misc_feature 276..662 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 693..845 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 846..1208 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735678.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X5, mRNA. (6364 bp)
misc_feature 277..663 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 694..846 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 847..1227 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735677.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X4, mRNA. (6367 bp)
misc_feature 265..651 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 682..834 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 835..1215 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735676.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Chanos chanos argonaute RISC catalytic component 2 (ago2), transcript variant X1, mRNA. (2938 bp)
misc_feature 474..698 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 726..878 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 879..1241 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_030788640.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Nipponia nippon argonaute RISC catalytic component 1 (AGO1), transcript variant X1, mRNA. (3057 bp)
misc_feature 256..480 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 508..660 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 661..1023 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_009470857.1 - Nipponia nippon (crested ibis) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X1, mRNA. (6379 bp)
misc_feature 277..663 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 694..846 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 847..1227 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735675.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Parambassis ranga argonaute RISC component 4 (ago4), transcript variant X7, mRNA. (6533 bp)
misc_feature 82..471 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 502..654 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 655..1017 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_028422514.1 - Parambassis ranga (Indian glassy fish) - NCBI
PREDICTED: Nipponia nippon argonaute RISC catalytic component 1 (AGO1), transcript variant X2, mRNA. (3021 bp)
misc_feature 205..429 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 457..609 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 610..972 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_009470858.1 - Nipponia nippon (crested ibis) - NCBI
PREDICTED: Nipponia nippon argonaute RISC catalytic component 2 (AGO2), transcript variant X2, mRNA. (2793 bp)
misc_feature 250..474 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 502..654 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 655..1020 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_009474019.1 - Nipponia nippon (crested ibis) - NCBI
PREDICTED: Nipponia nippon argonaute RISC catalytic component 2 (AGO2), transcript variant X1, mRNA. (2799 bp)
misc_feature 250..474 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 502..654 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 655..1020 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_009474018.1 - Nipponia nippon (crested ibis) - NCBI
PREDICTED: Mustelus asterias protein argonaute-1-like (LOC144509276), mRNA. (6536 bp)
misc_feature 183..575 /gene="LOC144509276" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 603..755 /gene="LOC144509276" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 756..1118 /gene="LOC144509276" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /...
XM_078237897.1 - Mustelus asterias (starry smooth-hound) - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : https://172.18.8.233:20082/Argonaute+%22PAZ+domain%22
lang : en | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.096 | 0.096 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.123 | 0.027 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.302 | 0.179 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.320 | 0.018 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]