GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2026-10-05 18:50:42, GGRNA : RefSeq release 233 (Jan, 2026)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. (288 bp)
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This...
XM_024651321.1 - Strongyloides ratti - NCBI
Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. (2979 bp)
misc_feature 463..708 /locus_tag="CDEST_03520" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 736..909 /locus_tag="CDEST_03520" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1024..1398 /locus_tag="CDEST_03520" /note="PAZ domain; Region: PAZ; pfam02170" /db_xref="CDD:460472" misc_feature 1477..2781 /locus_tag="CDEST_03520" /note="PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-induced silencing complex (RISC) and related complexes. The PIWI domain is the C-...
XM_062919679.1 - Colletotrichum destructivum - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. (903 bp)
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT...
XM_024650915.1 - Strongyloides ratti - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain and Protein of unknown function DUF2650 family-containing protein (SRAE_2000036100), partial mRNA. (3513 bp)
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 - Strongyloides ratti - NCBI
Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. (2346 bp)
LOCUS XM_062931429 2346 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. ACCESSION XM_062931429 VERSION XM_062931429.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062931429.1 - Colletotrichum destructivum - NCBI
Geosmithia morbida PAZ domain (GMORB2_2890), partial mRNA. (3108 bp)
misc_feature 490..732 /locus_tag="GMORB2_2890" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 772..921 /locus_tag="GMORB2_2890" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 925..1464 /locus_tag="GMORB2_2890" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like...
XM_035464866.1 - Geosmithia morbida - NCBI
Apiospora hydei protein argonaute (PG997_013705), partial mRNA. (3150 bp)
type_material="culture from type material of Arthrinium hydei" /db_xref="taxon:1337664" /chromosome="Unknown" gene 3150 /locus_tag="PG997_013705" /db_xref="GeneID:92051079" CDS <1..3150 /locus_tag="PG997_013705" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="protein argonaute" /protein_id="XP_066663711.1" /db_xref="GeneID:92051079" /translation="...
XM_066818019.1 - Apiospora hydei - NCBI
PREDICTED: Cryptomeria japonica protein argonaute 12-like (LOC131062786), transcript variant X5, mRNA. (1192 bp)
LOC131062786" /note="protein argonaute 12-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131062786" CDS 737..1144 /gene="LOC131062786" /codon_start=1 /product="protein argonaute 12-like isoform X3" /protein_id="XP_059066851.1" /db_xref="GeneID:131062786" /translation="MNLPYFIGNALRMDPRDVNAILSRNDSNGDSMRSRLKRLLNGLHVETTHIKYGYRNKSMTDVPVDALVFDSNGEQLIVTDYFQKQYNIRLGFREFPAIEAGSKDNFQRLKLVARIIISTFPLRLLLKIMAIQLVY" misc_feature 794..1051 /gene="LOC131062786" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing...
XM_059210868.1 - Cryptomeria japonica (Japanese cedar) - NCBI
Strongyloides ratti Protein argonaute-2 (SRAE_0000056900), partial mRNA. (846 bp)
codon_start=1 /product="Protein argonaute-2" /protein_id="XP_024500654.1" /db_xref="GeneID:36373813" /db_xref="InterPro:IPR003100" /db_xref="UniProtKB/TrEMBL:A0A090KV99" /translation="MNSQLFFLSIVALEKKNVCRFALSKANELSGNFGNDKLFYAYDGVKNLITNHLLNIDEFVIEREKLGIQYKSIFKNGSVRIFFEKTTRYHEIDLSVYASYLIVTQQALNDKNAGGGGYVQLNGEKSLTESSSFLKYENLRIGLGRIIVGSFTENIKFTNIDEPCFVLSINASKNVYYKSELLDKIIKDEIFRRNVPRLLKDFNAEINDSNIKGVHFETVYRKNGDIIKFRHDLHNHSTIDTIIDMKDGSQKSFAEYFQNKFNIQLKYPVWPLFVYKIHVTN" misc_feature 565..828 /locus_tag="SRAE_56900" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced...
XM_024646477.1 - Strongyloides ratti - NCBI
PREDICTED: Cryptomeria japonica protein argonaute 12-like (LOC131062786), transcript variant X3, mRNA. (1461 bp)
argonaute 12-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131062786" CDS 850..1413 /gene="LOC131062786" /codon_start=1 /product="uncharacterized protein LOC131062786 isoform X1" /protein_id="XP_059066849.1" /db_xref="GeneID:131062786" /translation="MFGSLSGFLSIYLACTAKYLNSESIHCCNSLLRAYGLASLHWQCLKNGSLRCMNLPYFIGNALRMDPRDVNAILSRNDSNGDSMRSRLKRLLNGLHVETTHIKYGYRNKSMTDVPVDALVFDSNGEQLIVTDYFQKQYNIRLGFREFPAIEAGSKDNFQRLKLVARIIISTFPLRLLLKIMAIQLVY" misc_feature 1063..1320 /gene="LOC131062786" /note="PAZ domain, argonaute_like subfamily. Argonaute...
XM_059210866.1 - Cryptomeria japonica (Japanese cedar) - NCBI
PREDICTED: Cryptomeria japonica protein argonaute 12-like (LOC131062786), transcript variant X1, mRNA. (1630 bp)
argonaute 12-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131062786" CDS 1019..1582 /gene="LOC131062786" /codon_start=1 /product="uncharacterized protein LOC131062786 isoform X1" /protein_id="XP_059066847.1" /db_xref="GeneID:131062786" /translation="MFGSLSGFLSIYLACTAKYLNSESIHCCNSLLRAYGLASLHWQCLKNGSLRCMNLPYFIGNALRMDPRDVNAILSRNDSNGDSMRSRLKRLLNGLHVETTHIKYGYRNKSMTDVPVDALVFDSNGEQLIVTDYFQKQYNIRLGFREFPAIEAGSKDNFQRLKLVARIIISTFPLRLLLKIMAIQLVY" misc_feature 1232..1489 /gene="LOC131062786" /note="PAZ domain, argonaute_like subfamily. Argonaute...
XM_059210864.1 - Cryptomeria japonica (Japanese cedar) - NCBI
Phytophthora ramorum Protein argonaute-4 (KRP23_1681), partial mRNA. (549 bp)
tag="KRP23_1681" /db_xref="GeneID:94222150" CDS 1..549 /locus_tag="KRP23_1681" /codon_start=1 /product="Protein argonaute-4" /protein_id="XP_067749014.1" /db_xref="GeneID:94222150" /translation="MDAIDFLCETLALRNMSTSVAKYQHSTFSKAIRDVKVNMIHRPGVKRSYRVNGLSRESADNTFFGDDEGQRMSIAQYFQQTYKIRLRYQKLSCLQRNYLPMEVCHVMAGQTCLHNVTDTQVANMIRLTCTPPGDRSSTSSARLTSTRTRSPKASTGCGKAENGGNDGPPAATSCDRVQWRGL" misc_feature 1..318 /locus_tag="KRP23_1681" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...
XM_067886343.1 - Phytophthora ramorum (sudden oak death agent) - NCBI
Guyanagaster necrorhizus MCA 3950 PAZ domain-containing protein (BT62DRAFT_1078051), mRNA. (1829 bp)
LOCUS XM_043179352 1829 bp mRNA linear PLN 22-NOV-2021 DEFINITION Guyanagaster necrorhizus MCA 3950 PAZ domain-containing protein (BT62DRAFT_1078051), mRNA. ACCESSION XM_043179352 VERSION XM_043179352.1 DBLINK BioProject: PRJNA756328 BioSample: SAMN05660966 KEYWORDS RefSeq. SOURCE Guyanagaster...protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 574..798 /locus_tag="BT62DRAFT_1078051" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 838..975 /locus_tag="BT62DRAFT_1078051" /note="Argonaute linker 1 domain;...
XM_043179352.1 - Guyanagaster necrorhizus - NCBI
PREDICTED: Cryptomeria japonica protein argonaute 12-like (LOC131062786), transcript variant X2, mRNA. (1537 bp)
GeneID:131062786" /translation="MFGSLSGFLSIYLACTAKYLNSESIHCCNSLLRAYGLASLHWQCLKNGSLRCMNLPYFIGNALRMDPRDVNAILSRNDSNGDSMRSRLKRLLNGLHVETTHIKYGYRNKSMTDVPVDALVFDSNGEQLIVTDYFQKQYNIRLGFREFPAIEAGSKDNFQRLKLVARIIISTFPLRLLLKIMAIQLVY" misc_feature 1139..1396 /gene="LOC131062786" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" ORIGIN //...
XM_059210865.1 - Cryptomeria japonica (Japanese cedar) - NCBI
PREDICTED: Alnus glutinosa protein argonaute 5-like (LOC133878273), mRNA. (1432 bp)
argonaute 5-like" /protein_id="XP_062172792.1" /db_xref="GeneID:133878273" /translation="MSSRRGGGRQPDSRLDQPSPAAYQGGGGRGREGGGGSGRGASSTFPPAPAPEASFPANPPPSASPAGPPSATLASSDSSAASSSARPPVSSEASSSSRPLVPDSTCINMFDGRYNVMGRSFIHPELGQTGELGNGLEYWRGFYQSLRPTQMGLSLNIDVSARAFYEPILVTDFVAKHFNFNVSMPLSDQDRLKIQKALRRVKVEVTNREYSRSYKVTAVTTQPTSQLTFTLDDQGTRISVAQYYREKYNIALKNVNLPALQAGSDTKPIYLPMELCKISPGQRYYKRLNERQVTNLLRATSQRPQDRQNSINQECIQPDDT" misc_feature 619..765 /gene="LOC133878273" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 775..1101 /gene="LOC133878273" /note="PAZ domain...
XM_062316808.1 - Alnus glutinosa - NCBI
PREDICTED: Hordeum vulgare subsp. vulgare protein argonaute 1D-like (LOC123405589), mRNA. (465 bp)
similarity to: 2 Proteins" /db_xref="GeneID:123405589" CDS 1..465 /gene="LOC123405589" /codon_start=1 /product="protein argonaute 1D-like" /protein_id="XP_044955160.1" /db_xref="GeneID:123405589" /translation="MSATTFIEPLPVIDYAAQLLRSDIHSRPLSDAERVKIKKALRGVKVEVTHRGNMRRKYRISGLTTQATRELTFPVDEGGTIKSVVQYFQETYGFAIKHTYLPCLQVGNQQRPNYLPMEKISLGNKQQYQLQMQLFSGDAIRIPRRPIDSSPNSN" misc_feature 25..354 /gene="LOC123405589" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The...
XM_045099225.1 - Hordeum vulgare subsp. vulgare (domesticated barley) - NCBI
PREDICTED: Drosophila nasuta protein argonaute-2 (LOC132789234), transcript variant X3, mRNA. (1787 bp)
misc_feature 882..1097 /gene="LOC132789234" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1128..1271 /gene="LOC132789234" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1278..1592 /gene="LOC132789234" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_060797114.1 - Drosophila nasuta - NCBI
PREDICTED: Triticum dicoccoides protein argonaute 1A-like (LOC119345289), mRNA. (1840 bp)
for all annotated introns" /db_xref="GeneID:119345289" CDS 49..507 /gene="LOC119345289" /codon_start=1 /product="protein argonaute 1A-like" /protein_id="XP_037471322.1" /db_xref="GeneID:119345289" /translation="MAVAVGTTKQAVMAAVAVGTAKEAARACTLPTSCGSTPRNLRRDLIRGTNGLHYLKIKKALRGPRVVVTHQVEVRRKYRIAGLTNQSSRDSRFELSTGETKPVRDFFRGTYKLQLRYVFSPACKLVQSRNPTIFQWRSAIYSFRTAVPKEAR" misc_feature 163..>399 /gene="LOC119345289" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The...
XM_037615425.1 - Triticum dicoccoides - NCBI
Penicillium cosmopolitanum uncharacterized protein (N7509_004117), partial mRNA. (3114 bp)
cosmopolitanum" /mol_type="mRNA" /strain="IBT 29677" /culture_collection="IBT:29677" /db_xref="taxon:1131564" /chromosome="Unknown" gene 3114 /locus_tag="N7509_004117" /db_xref="GeneID:81367734" CDS 1..3114 /locus_tag="N7509_004117" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; N-terminal domain of argonaute; PAZ domain; Piwi domain" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_056491488.1" /db_xref="GeneID:81367734" /translation="...
XM_056628754.1 - Penicillium cosmopolitanum - NCBI
PREDICTED: Cryptomeria japonica protein argonaute 12-like (LOC131062786), transcript variant X4, mRNA. (1871 bp)
GeneID:131062786" /translation="MFGSLSGFLSIYLACTAKYLNSESIHCCNSLLRAYGLASLHWQCLKNGSLRCMNLPYFIGNALRMDPRDVNAILSRNDSNGDSMRSRLKRLLNGLHVETTHIKYGYRNKSMTDVPVDALVFDSNGEQLIVTDYFQKQYNIRLGFREFPAIEAGSKDNFQRLKLVARIIISTFPLSFVVFRRINLI" misc_feature 1162..1419 /gene="LOC131062786" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" polyA_site...
XM_059210867.1 - Cryptomeria japonica (Japanese cedar) - NCBI
PREDICTED: Diaphorina citri protein argonaute-4-like (LOC103524044), partial mRNA. (231 bp)
alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:103524044" CDS 9..>231 /gene="LOC103524044" /codon_start=1 /product="protein argonaute-4-like" /protein_id="XP_008487272.1" /db_xref="GeneID:103524044" /translation="MKRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMKLRFPHLPCLQVGQEHKHTYLPLEVSIQRC" misc_feature <9..215 /gene="LOC103524044" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the...
XM_008489050.1 - Diaphorina citri (Asian citrus psyllid) - NCBI
PREDICTED: Lotus japonicus protein argonaute 12-like (LOC130721920), transcript variant X1, mRNA. (1494 bp)
misc_feature 1357 /gene="LOC130721920" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 533..868 /gene="LOC130721920" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(677..679,722..724,749..751,761..763,815..817, 836..838,842..844) /gene="LOC130721920" /note="...
XM_057572505.1 - Lotus japonicus - NCBI
PREDICTED: Drosophila obscura protein argonaute-2-like (LOC111068737), mRNA. (740 bp)
genomic feature by RNAseq alignments" /db_xref="GeneID:111068737" CDS 342..740 /gene="LOC111068737" /codon_start=1 /product="protein argonaute-2-like" /protein_id="XP_041451464.1" /db_xref="GeneID:111068737" /translation="MCRQYHLKVSRGYTKSMRYKLPASKQTFVADKGRMTVAEYSKSRGRILKYPKLHCLHVGPPQKTIYLPIGMCAAEGKQSVNRNDATLQSAAMDKIAATSSSTSTNARKSKIMELLHCFIASTTTLIRPDLPQ" misc_feature <363..548 /gene="LOC111068737" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain...
XM_041595530.1 - Drosophila obscura - NCBI
PREDICTED: Malus sylvestris protein argonaute MEL1-like (LOC126614318), transcript variant X5, mRNA. (1438 bp)
gene="LOC126614318" /codon_start=1 /product="protein argonaute MEL1-like isoform X4" /protein_id="XP_050137872.1" /db_xref="GeneID:126614318" /translation="MVTEFVKKLLSNRQLSRPLPDRDRLKEKKPLKGVKVPLSYEEHTGYEITRVSVEPQSKLKFTHERYNIGLRDVATPALQTGRDSKPVYLPMEVPVQMVKHNGHNKDEVIQREIGMTIREDMTLVNARVLWPPLKMFNGVQVDFWAYVDFSLLDQSFNFRFCEDLVRPCNSKGVHFHPQPLLLHQSAHPGKIERVLGDIHKMSGKQLEEVGQKGRHLQLLIIILPDVTGLYEKMIKRFRESELGVVSQCCQPTAASRLSKQYLENLSLEISEVWWKEHCCHSKKDSSS" misc_feature 410..685 /gene="LOC126614318" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and...
XM_050281915.1 - Malus sylvestris (European crab apple) - NCBI
PREDICTED: Malus sylvestris protein argonaute MEL1-like (LOC126614318), transcript variant X4, mRNA. (1494 bp)
gene="LOC126614318" /codon_start=1 /product="protein argonaute MEL1-like isoform X4" /protein_id="XP_050137871.1" /db_xref="GeneID:126614318" /translation="MVTEFVKKLLSNRQLSRPLPDRDRLKEKKPLKGVKVPLSYEEHTGYEITRVSVEPQSKLKFTHERYNIGLRDVATPALQTGRDSKPVYLPMEVPVQMVKHNGHNKDEVIQREIGMTIREDMTLVNARVLWPPLKMFNGVQVDFWAYVDFSLLDQSFNFRFCEDLVRPCNSKGVHFHPQPLLLHQSAHPGKIERVLGDIHKMSGKQLEEVGQKGRHLQLLIIILPDVTGLYEKMIKRFRESELGVVSQCCQPTAASRLSKQYLENLSLEISEVWWKEHCCHSKKDSSS" misc_feature 466..741 /gene="LOC126614318" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and...
XM_050281914.1 - Malus sylvestris (European crab apple) - NCBI
PREDICTED: Myotis brandtii protein argonaute-2-like (LOC106728082), mRNA. (1157 bp)
except=(pos:743..745,aa:OTHER) /product="LOW QUALITY PROTEIN: protein argonaute-2-like" /protein_id="XP_014404516.1" /db_xref="GeneID:106728082" /translation="MTCALGPQVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASNQTXRLPRPVALPPGRGPVGTVTPGKRIQSVLKLAQGSQTSQWKEPGGSRQPPRCVEQGPLCPELGAEHAGSSGLLSLPQFLGVAPS" misc_feature 742 /gene="LOC106728082" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an...
XM_014549030.1 - Myotis brandtii (Brandt's bat) - NCBI
PREDICTED: Folsomia candida protein argonaute-1-like (LOC110851464), transcript variant X2, mRNA. (3190 bp)
start=1 /product="protein argonaute-1-like" /protein_id="XP_035708536.1" /db_xref="GeneID:110851464" /translation="MHFISCNRSFFNPFPQNRHPLDSMLELLHGHYQSLCLGSENTATLNIDLATKAFYKQTPLAEFARSVLKLHKDDSLDLVCWDDRTIDVVSEALRGKLIKYGTGRCNQKGVYEKYHQFTANGLILRSAENYEFNMTDEKGITRSINIVQYMQKFKNTTIRFPKWPVVHIGNKNMTNYVPLELCMIITQPYRRKMEPKLTSAMIKGVAIEPVARFKAIDQARKGSSSKPTELIPRASKFYRDSKSPPFVRVIWIVHVESGREGVPIRKL" misc_feature 239..388 /gene="LOC110851464" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 395..775 /gene="LOC110851464" /note="PAZ domain, argonaute_like subfamily....
XM_035852643.1 - Folsomia candida - NCBI
PREDICTED: Folsomia candida protein argonaute-1-like (LOC110851464), transcript variant X1, mRNA. (3768 bp)
start=1 /product="protein argonaute-1-like" /protein_id="XP_035708535.1" /db_xref="GeneID:110851464" /translation="MHFISCNRSFFNPFPQNRHPLDSMLELLHGHYQSLCLGSENTATLNIDLATKAFYKQTPLAEFARSVLKLHKDDSLDLVCWDDRTIDVVSEALRGKLIKYGTGRCNQKGVYEKYHQFTANGLILRSAENYEFNMTDEKGITRSINIVQYMQKFKNTTIRFPKWPVVHIGNKNMTNYVPLELCMIITQPYRRKMEPKLTSAMIKGVAIEPVARFKAIDQARKGSSSKPTELIPRASKFYRDSKSPPFVRVIWIVHVESGREGVPIRKL" misc_feature 817..966 /gene="LOC110851464" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 973..1353 /gene="LOC110851464" /note="PAZ domain, argonaute_like subfamily....
XM_035852642.1 - Folsomia candida - NCBI
Trypanosoma grayi putative argonaute-like protein partial mRNA. (2661 bp)
LOCUS XM_009313852 2661 bp mRNA linear INV 09-JUN-2015 DEFINITION Trypanosoma grayi putative argonaute-like protein partial mRNA. ACCESSION XM_009313852 VERSION XM_009313852.1 DBLINK BioProject:...G3DSA:2.170.260.10: paz domain|aa:283-376|eval:4.3E-4; PTHR22892: piwi-related|aa:4-886|eval:1.5E-149; PTHR22892:SF21: NA|aa:4-886|eval:1.5E-149; PF02170: PAZ domain|aa:276-389|eval:1.8E-7; PF02171:...PAZ; cl00301" /db_xref="CDD:469713" misc_feature 1195..1332 /locus_tag="DQ04_04891000" /note="Argonaute linker 2 domain; Region: ArgoL2; pfam16488" /db_xref="CDD:465136" misc_feature 1633..2592 /locus...
XM_009313852.1 - Trypanosoma grayi - NCBI
Apiospora marii eukaryotic translation initiation factor 2c (PG985_013254), partial mRNA. (3111 bp)
mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3111 /locus_tag="PG985_013254" /db_xref="GeneID:92066081" CDS 1..3111 /locus_tag="PG985_013254" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="eukaryotic translation initiation factor 2c" /protein_id="XP_066677760.1" /db_xref="GeneID:92066081" /...
XM_066833020.1 - Apiospora marii - NCBI
Apiospora marii argonaute (PG985_005260), partial mRNA. (3114 bp)
marii" /mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3114 /locus_tag="PG985_005260" /db_xref="GeneID:92058090" CDS 1..3114 /locus_tag="PG985_005260" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; N-terminal domain of argonaute; PAZ domain profile.; Piwi domain; Piwi domain profile." /codon_start=1 /product="argonaute" /protein_id="XP_066688189.1" /db_xref="GeneID:92058090" /translation="...
XM_066825029.1 - Apiospora marii - NCBI
Apiospora phragmitis uncharacterized protein (PG994_014412), partial mRNA. (3012 bp)
type_material="culture from type material of Arthrinium phragmitis" /db_xref="taxon:2905665" /chromosome="Unknown" gene 3012 /locus_tag="PG994_014412" /db_xref="GeneID:92098884" CDS 1..3012 /locus_tag="PG994_014412" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_066708950.1" /db_xref="GeneID:92098884" /translation="...
XM_066865821.1 - Apiospora phragmitis - NCBI
PREDICTED: Helianthus annuus protein argonaute 1A (LOC110901336), transcript variant X5, mRNA. (652 bp)
introns" /db_xref="GeneID:110901336" CDS 92..637 /gene="LOC110901336" /codon_start=1 /product="protein argonaute 1A isoform X3" /protein_id="XP_035838402.1" /db_xref="GeneID:110901336" /translation="MGLSLNIDMAATAFVEAVHVIDFVKQLLNRNDTTRPLSDADRIKKALKGVKVEITHRGTMRRRFNISGLTSQATRELQFTVGGDGDTVTKYVVDYFKDAYGFSIQHVHWPCLQLGGTHRKNYMPMEVCKIVAGQRYSRKLNERQVTALLKVTCQRPQDREHGILKVMLSNLPMNHHVMCKS" misc_feature 149..484 /gene="LOC110901336" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_035982509.1 - Helianthus annuus (common sunflower) - NCBI
PREDICTED: Acropora millepora protein argonaute-4-like (LOC122956347), mRNA. (1071 bp)
misc_feature 187..>942 /gene="LOC122956347" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 493..858 /gene="LOC122956347" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(649..651,694..696,739..741,751..753,805..807, 826..828,832..834) /gene="LOC122956347" /note="...
XM_044316009.1 - Acropora millepora - NCBI
PREDICTED: Helianthus annuus protein argonaute 1A (LOC110901336), transcript variant X4, mRNA. (1487 bp)
introns" /db_xref="GeneID:110901336" CDS 906..1472 /gene="LOC110901336" /codon_start=1 /product="protein argonaute 1A isoform X2" /protein_id="XP_035838401.1" /db_xref="GeneID:110901336" /translation="MLIPSKSFLTLSLTDMAATAFVEAVHVIDFVKQLLNRNDTTRPLSDADRIKKALKGVKVEITHRGTMRRRFNISGLTSQATRELQFTVGGDGDTVTKYVVDYFKDAYGFSIQHVHWPCLQLGGTHRKNYMPMEVCKIVAGQRYSRKLNERQVTALLKVTCQRPQDREHGILKVMLSNLPMNHHVMCKS" misc_feature 984..1319 /gene="LOC110901336" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA...
XM_035982508.1 - Helianthus annuus (common sunflower) - NCBI
PREDICTED: Helianthus annuus protein argonaute 1A (LOC110901336), transcript variant X3, mRNA. (1285 bp)
GeneID:110901336" CDS 608..1270 /gene="LOC110901336" /codon_start=1 /product="protein argonaute 1A isoform X1" /protein_id="XP_035838400.1" /db_xref="GeneID:110901336" /translation="MVVCIVKHDMEIIHLFTDASSSTIWRSSTFSPMLIPSKSFLTLSLTDMAATAFVEAVHVIDFVKQLLNRNDTTRPLSDADRIKKALKGVKVEITHRGTMRRRFNISGLTSQATRELQFTVGGDGDTVTKYVVDYFKDAYGFSIQHVHWPCLQLGGTHRKNYMPMEVCKIVAGQRYSRKLNERQVTALLKVTCQRPQDREHGILKVMLSNLPMNHHVMCKS" misc_feature 782..1117 /gene="LOC110901336" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role...
XM_035982507.1 - Helianthus annuus (common sunflower) - NCBI
PREDICTED: Helianthus annuus protein argonaute 1A (LOC110901336), transcript variant X2, mRNA. (1546 bp)
GeneID:110901336" CDS 869..1531 /gene="LOC110901336" /codon_start=1 /product="protein argonaute 1A isoform X1" /protein_id="XP_035838399.1" /db_xref="GeneID:110901336" /translation="MVVCIVKHDMEIIHLFTDASSSTIWRSSTFSPMLIPSKSFLTLSLTDMAATAFVEAVHVIDFVKQLLNRNDTTRPLSDADRIKKALKGVKVEITHRGTMRRRFNISGLTSQATRELQFTVGGDGDTVTKYVVDYFKDAYGFSIQHVHWPCLQLGGTHRKNYMPMEVCKIVAGQRYSRKLNERQVTALLKVTCQRPQDREHGILKVMLSNLPMNHHVMCKS" misc_feature 1043..1378 /gene="LOC110901336" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key...
XM_035982506.1 - Helianthus annuus (common sunflower) - NCBI
PREDICTED: Helianthus annuus protein argonaute 1A (LOC110901336), transcript variant X1, mRNA. (1531 bp)
GeneID:110901336" CDS 854..1516 /gene="LOC110901336" /codon_start=1 /product="protein argonaute 1A isoform X1" /protein_id="XP_035838398.1" /db_xref="GeneID:110901336" /translation="MVVCIVKHDMEIIHLFTDASSSTIWRSSTFSPMLIPSKSFLTLSLTDMAATAFVEAVHVIDFVKQLLNRNDTTRPLSDADRIKKALKGVKVEITHRGTMRRRFNISGLTSQATRELQFTVGGDGDTVTKYVVDYFKDAYGFSIQHVHWPCLQLGGTHRKNYMPMEVCKIVAGQRYSRKLNERQVTALLKVTCQRPQDREHGILKVMLSNLPMNHHVMCKS" misc_feature 1028..1363 /gene="LOC110901336" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key...
XM_035982505.1 - Helianthus annuus (common sunflower) - NCBI
PREDICTED: Homarus americanus protein argonaute-3-like (LOC121865476), transcript variant X4, mRNA. (1446 bp)
start=1 /product="protein argonaute-3-like isoform X4" /protein_id="XP_042220913.1" /db_xref="GeneID:121865476" /translation="MVEVMFRHYRAIKYELVGRRNFYSAGGEFGTPYPIGCGKEGVTGFFGSMRPASWKDGSLLLNIDVAHTAFYKEQPLLNFIQDFMNFREDDFHRPLEPFKRSKLLQELRNIRVQVTHSNIPRTYKIIDVSEHSAEKQTFPLKDENTGNTVYCTIENYFKNQYGKKIKFPKLNCVQVSPAERNVFIPFECCKIYKGQRVVKKLSDRETAQFIRTTAVPPATRKKQICNIHRTNDFTQDPMLKNLQFSIAERG" misc_feature 731..892 /gene="LOC121865476" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 893..1249 /gene="LOC121865476" /note="PAZ domain, argonaute_like subfamily....
XM_042364979.1 - Homarus americanus (American lobster) - NCBI
PREDICTED: Homarus americanus protein argonaute-3-like (LOC121865476), transcript variant X3, mRNA. (1421 bp)
product="protein argonaute-2-like isoform X3" /protein_id="XP_042220904.1" /db_xref="GeneID:121865476" /translation="MNTPRHRGFVILIYLLFGFSPKIDLEESDGKRTQYKISLMVRHRANLQELTEALNCSAREQKTLPLNIFQMVEVMFRHYRAIKYELVGRRNFYSAGGEFGTPYPIGCGKEGVTGFFGSMRPASWKDGSLLLNIDVAHTAFYKEQPLLNFIQDFMNFREDDFHRPLEPFKRSKLLQELRNIRVQVTHSNIPRTYKIIDVSEHSAEKQTFPLKDENTGNTVYCTIENYFKNQYGKKIKFPKLNCVQVSPAERNVFIPFEGPFCFC" misc_feature 719..880 /gene="LOC121865476" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 881..1240 /gene="LOC121865476" /note="PAZ domain, argonaute_like subfamily....
XM_042364970.1 - Homarus americanus (American lobster) - NCBI
PREDICTED: Homarus americanus protein argonaute-1-like (LOC121877077), partial mRNA. (1065 bp)
in argonaute-1-like" /protein_id="XP_042238640.1" /db_xref="GeneID:121877077" /translation="MEIFEKMKMIYEKDFKNYPLAYDSERNAYSVGVIPALQTPDCQSTYEIDLEESDGKRTQYKISLMVRHRANLQELTEALNCSAREQKTLPLNIFQMVEVMFRHYRAIKYELVGRRNFYSAGGEFGTPYPIGCGKEGVTGFFGSMRPASWKDGSLLLNIDVAHTAFYKEQPLLNFIQDFMNFREDDFHRPLEPFKRSKLLQELRNIRVQVTHSNIPRTYKIIDVSEHSAEKQTFPLKDENTGNTVYCTIENYFKNQYGKKIKFPKLNCVQVSPAERNVFIPFE" misc_feature 226..>1065 /gene="LOC121877077" /note="protein argonaute; Provisional; Region: PLN03202" /db_xref="CDD:215631" misc_feature 721..1065 /gene="LOC121877077" /note="PAZ domain, argonaute_like subfamily. Argonaute...
XM_042382706.1 - Homarus americanus (American lobster) - NCBI
PREDICTED: Homarus americanus protein argonaute-3-like (LOC121865476), transcript variant X2, mRNA. (2342 bp)
protein argonaute-2-like isoform X2" /protein_id="XP_042220895.1" /db_xref="GeneID:121865476" /translation="MNTPRHRGFVILIYLLFGFSPKIDLEESDGKRTQYKISLMVRHRANLQELTEALNCSAREQKTLPLNIFQMVEVMFRHYRAIKYELVGRRNFYSAGGEFGTPYPIGCGKEGVTGFFGSMRPASWKDGSLLLNIDVAHTAFYKEQPLLNFIQDFMNFREDDFHRPLEPFKRSKLLQELRNIRVQVTHSNIPRTYKIIDVSEHSAEKQTFPLKDENTGNTVYCTIENYFKNQYGKKIKFPKLNCVQVSPAERNVFIPFEPPTSNTTSSSAPAWRRPWRP" misc_feature 721..882 /gene="LOC121865476" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 883..1227 /gene="LOC121865476" /note="PAZ domain, argonaute_like subfamily...
XM_042364961.1 - Homarus americanus (American lobster) - NCBI
Penicillium maclennaniae uncharacterized protein (N7477_005031), partial mRNA. (2934 bp)
collection="IBT:15551" /type_material="culture from holotype of Penicillium maclennaniae" /db_xref="taxon:1343394" /chromosome="Unknown" gene 2934 /locus_tag="N7477_005031" /db_xref="GeneID:81656952" CDS 1..2934 /locus_tag="N7477_005031" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; N-terminal domain of argonaute; PAZ domain; Piwi domain" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_056823475.1" /db_xref="GeneID:81656952" /translation="...
XM_056966694.1 - Penicillium maclennaniae - NCBI
PREDICTED: Sorex fumeus argonaute RISC catalytic component 3 (AGO3), transcript variant X4, mRNA. (4538 bp)
misc_feature 140..481 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(275..277,320..322,362..364,374..376,428..430, 449..451,455..457) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 614..1891 /gene="AGO3" /note="PIWI...
XM_056122749.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Sorex fumeus argonaute RISC catalytic component 3 (AGO3), transcript variant X3, mRNA. (4564 bp)
misc_feature 166..507 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(301..303,346..348,388..390,400..402,454..456, 475..477,481..483) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 640..1917 /gene="AGO3" /note="PIWI...
XM_056122748.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Sorex fumeus argonaute RISC catalytic component 3 (AGO3), transcript variant X2, mRNA. (4690 bp)
misc_feature 292..633 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(427..429,472..474,514..516,526..528,580..582, 601..603,607..609) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 766..2043 /gene="AGO3" /note="PIWI...
XM_056122747.1 - Sorex fumeus (smoky shrew) - NCBI
PREDICTED: Delphinus delphis argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (7705 bp)
misc_feature 961..1302 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1096..1098,1141..1143,1183..1185,1195..1197, 1249..1251,1270..1272,1276..1278) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1435..2712 /gene="AGO3" /...
XM_060019255.1 - Delphinus delphis (saddleback dolphin) - NCBI
PREDICTED: Homarus americanus protein argonaute-3-like (LOC121865476), transcript variant X1, mRNA. (1434 bp)
misc_feature 719..880 /gene="LOC121865476" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 881..1237 /gene="LOC121865476" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1031..1033,1076..1078,1121..1123,1133..1135, 1187..1189,1208..1210,1214..1216) /gene="...
XM_042364951.1 - Homarus americanus (American lobster) - NCBI
PREDICTED: Sorex fumeus argonaute RISC component 1 (AGO1), transcript variant X2, mRNA. (6624 bp)
misc_feature 183..524 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(318..320,363..365,405..407,417..419,471..473, 492..494,498..500) /gene="AGO1" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 657..1934 /gene="AGO1" /note="PIWI...
XM_056122751.1 - Sorex fumeus (smoky shrew) - NCBI
Penicillium chermesinum Qde2 (N7468_005915), partial mRNA. (3165 bp)
Penicillium chermesinum" /mol_type="mRNA" /strain="IBT 19713" /culture_collection="IBT:19713" /db_xref="taxon:63820" /chromosome="Unknown" gene 3165 /locus_tag="N7468_005915" /db_xref="GeneID:83202514" CDS 1..3165 /locus_tag="N7468_005915" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; N-terminal domain of argonaute; PAZ domain; Piwi domain" /codon_start=1 /product="Qde2" /protein_id="XP_058330951.1" /db_xref="GeneID:83202514" /translation="...
XM_058475211.1 - Penicillium chermesinum - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : https://172.18.8.233:20082/Argonaute+%22PAZ+domain%22
lang : en | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.101 | 0.101 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.122 | 0.020 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.194 | 0.072 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.205 | 0.010 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]