GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 08:09:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_008489050             231 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Diaphorina citri protein argonaute-4-like
            (LOC103524044), partial mRNA.
ACCESSION   XM_008489050
VERSION     XM_008489050.1
DBLINK      BioProject: PRJNA251515
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Diaphorina citri (Asian citrus psyllid)
  ORGANISM  Diaphorina citri
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha;
            Psylloidea; Psyllidae; Diaphorininae; Diaphorina.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_007459459.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Diaphorina citri Annotation Release
                                           102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 5% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..231
                     /organism="Diaphorina citri"
                     /mol_type="mRNA"
                     /db_xref="taxon:121845"
                     /chromosome="Unknown"
                     /collection_date="2010"
     gene            1..>231
                     /gene="LOC103524044"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 94% coverage of the annotated
                     genomic feature by RNAseq alignments, including 14 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:103524044"
     CDS             9..>231
                     /gene="LOC103524044"
                     /codon_start=1
                     /product="protein argonaute-4-like"
                     /protein_id="XP_008487272.1"
                     /db_xref="GeneID:103524044"
                     /translation="
MKRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMKLRFPHLPCLQVGQEHKHTYLPLEVSIQRC"
     misc_feature    <9..215
                     /gene="LOC103524044"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(21..23,66..68,108..110,120..122,174..176,195..197,
                     201..203)
                     /gene="LOC103524044"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
ORIGIN      
gcggcacgatgaagcgaaagtatcgcgtgtgtaacgtcacacgccgcccggctcagatgcaatcattccccttacaattagaaaacggacaaacggtggaatgtactgtagccaaatacttcctggacaaatacaagatgaagttacgcttcccacatctgccctgtttacaagtgggacaagagcacaagcacacctacttgcctcttgaagtaagtatacaacggtgcg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]