ver.2
Help
|
Advanced search
|
English
旧バージョン
2025-12-10 23:20:12, GGRNA : RefSeq release 232 (Sep, 2025)
Summary:
Results:
検索語に色がつきます。重なると色が濃く表示されます。
CDS 1..1077 /gene="LOC128649299" /codon_start=1 /product="keratin-associated protein 16-1-like" /protein_id="XP_053558476.1" /db_xref="GeneID:128649299" /translation="MCEHAMCERAMCEHAISERAMCERDICEHAMCEHAMCEHAMCVHAMYVRDICEHAISERAMCERDICECAISEHAMCEHAMCVRAMCECAICECAMCVRAICECAISERAMCERDICERAISERAMCERDICERAISKRAMWERAMCKRAMCEHDICEHAISERAMCERDICERAISKRAMCERDICEHAISERAMCECDICERAISKRAMCERAMCERDICERAISERAMCERDICERAISKRAMCERDICERAISERAMCERDICEHAIRERAMCVRDICEHAIRERAMCERDICERAISKRAMWERAMCERAMCEHDICERAISERAMCERAIREHAMCERDICEHAMCRLTIFP" ORIGIN //...
AA_position 115
XM_053702501.1 -
Bombina bombina (fire-bellied toad) -
NCBI
AL390254.6 8880-8955 6206-10641 AL390254.6 9326-13761 FEATURES Location/Qualifiers source 1..10641 /organism="Homo sapiens" /mol_type="transcribed RNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..10641 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" misc_RNA 1..10641 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /product="dicer 1, ribonuclease III, transcript variant...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NR_172716.1 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
AL390254.6 8880-8955 6039-10474 AL390254.6 9326-13761 FEATURES Location/Qualifiers source 1..10474 /organism="Homo sapiens" /mol_type="transcribed RNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..10474 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" misc_RNA 1..10474 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /product="dicer 1, ribonuclease III, transcript variant...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NR_172718.1 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
AL390254.6 8880-8955 5872-10307 AL390254.6 9326-13761 FEATURES Location/Qualifiers source 1..10307 /organism="Homo sapiens" /mol_type="transcribed RNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..10307 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" misc_RNA 1..10307 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /product="dicer 1, ribonuclease III, transcript variant...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NR_172719.1 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
AL390254.6 8880-8955 6075-10510 AL390254.6 9326-13761 FEATURES Location/Qualifiers source 1..10510 /organism="Homo sapiens" /mol_type="transcribed RNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..10510 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" misc_RNA 1..10510 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /product="dicer 1, ribonuclease III, transcript variant...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NR_172720.1 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
AL356017.3 56223-56258 c 37-5657 HM595745.1 1-5621 5658-9921 AL390254.6 9498-13761 FEATURES Location/Qualifiers source 1..9921 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..9921 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" exon 1..189 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /inference="alignment:Splign:2.1.0" variation...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NM_001195573.1 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
AJ132261.2 18-6097 6081-8946 AL390254.6 9579-12444 8947-10263 AF007142.1 495-1811 FEATURES Location/Qualifiers source 1..10263 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..10263 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" exon 1..179 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /inference="alignment:Splign:2.1.0" variation...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NM_001271282.3 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
AL356017.3 80178-80284 c 108-6144 AB023145.2 1-6037 6145-10384 AL390254.6 9522-13761 FEATURES Location/Qualifiers source 1..10384 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..10384 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" exon 1..300 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /inference="alignment:Splign:2.1.0"...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NM_177438.3 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
AJ132261.2 204-6097 5978-8843 AL390254.6 9579-12444 8844-10160 AF007142.1 495-1811 FEATURES Location/Qualifiers source 1..10160 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..10160 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" exon 1..80 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /inference="alignment:Splign:2.1.0" variation...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NM_001291628.2 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
AJ132261.2 204-6097 6149-9014 AL390254.6 9579-12444 9015-10377 AF007142.1 495-1857 FEATURES Location/Qualifiers source 1..10377 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..10377 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" exon 1..80 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /inference="alignment:Splign:2.1.0" variation...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NM_030621.4 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
AL390254.6 10981-11140 6333-7334 AL390254.6 12760-13761 FEATURES Location/Qualifiers source 1..7334 /organism="Homo sapiens" /mol_type="transcribed RNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..7334 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" misc_RNA 1..7334 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /product="dicer 1, ribonuclease III, transcript variant...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NR_172715.1 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
AL390254.6 10981-11140 6427-7428 AL390254.6 12760-13761 FEATURES Location/Qualifiers source 1..7428 /organism="Homo sapiens" /mol_type="transcribed RNA" /db_xref="taxon:9606" /chromosome="14" /map="14q32.13" gene 1..7428 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /note="dicer 1, ribonuclease III" /db_xref="GeneID:23405" /db_xref="HGNC:HGNC:17098" /db_xref="MIM:606241" misc_RNA 1..7428 /gene="DICER1" /gene_synonym="aviD; DCR1; Dicer; Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2" /product="dicer 1, ribonuclease III, transcript variant...
Synonym: aviD; DCR1;
Dicer;
Dicer1e; GLOW; HERNA; K12H4.8-LIKE; MNG1; RMSE2
NR_172717.1 -
Homo sapiens (human) -
NCBI -
UCSC -
RefEx(expression)
db_xref="GeneID:128649308" CDS 1..1401 /gene="LOC128649308" /codon_start=1 /product="keratin-associated protein 16-1-like" /protein_id="XP_053558487.1" /db_xref="GeneID:128649308" /translation="MCERAMCEHAISERAMCERDICEHAMCEHAMYVRDICEHAISERAMCERDICECAISEHAMCERAMCVRAMCECAICECAMCVRAICECAISERAMCERDICERAISERVMCERDICERAISKRAMCERAMCERAMCEHDICERAISERAMCERDICEHAIRERAMCERDICERAISERAMCERAMCVRAICERAISEHAMCERDICEHAISERAMCECDICERAISERAMCVRAICERAISERAMCVRTICERSISEHAMCERAMCVRAMFECAICERAMCECDICERAISEHAMCERAMCERAICECAISERAMCEHDICEHAMCVRAICERAISERAMCVHTICECAISEHAMCERAMCVRAMCECAICERAMCVRAICECAISERAMCERDICERAISEHGM...
AA_position 100
XM_053702512.1 -
Bombina bombina (fire-bellied toad) -
NCBI
order(5026..5028,5341..5343,5350..5352) /gene="dicer1" /gene_synonym="dcr1; dicer; herna" /note="metal binding site [ion binding]; metal-binding site" /db_xref="CDD:238333" misc_feature 5329..5331 /gene="dicer1" /gene_synonym="dcr1; dicer; herna" /note="Important for activity. /evidence=ECO:0000250; propagated from UniProtKB/Swiss-Prot (B3DLA6.2); other site" misc_feature 5464..5652 /gene="dicer1" /gene_synonym="dcr1; dicer; herna" /note="double-stranded RNA binding motif of endoribonuclease Dicer and similar proteins; Region: DSRM_DICER; cd10843" /db_xref="CDD:380680" misc_feature order...
Synonym: dcr1;
dicer; herna
NM_001129918.2 -
Xenopus tropicalis (tropical clawed frog) -
NCBI -
UCSC -
Xenbase
LOCUS XR_009816063 3396 bp RNA linear VRT 04-APR-2025 DEFINITION PREDICTED: Nerophis lumbriciformis dicer 1, ribonuclease type III (dicer1), transcript variant X2, misc_RNA. ACCESSION XR_009816063 VERSION XR_009816063.1 DBLINK BioProject: PRJNA1054156 KEYWORDS RefSeq. SOURCE Nerophis lumbriciformis (worm pipefish) ORGANISM Nerophis lumbriciformis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei; Syngnathidae; Nerophis. COMMENT MODEL REFSEQ: This record is...
XR_009816063.1 -
Nerophis lumbriciformis (worm pipefish) -
NCBI
FEATURES Location/Qualifiers source 1..2681 /organism="Engystomops pustulosus" /mol_type="mRNA" /db_xref="taxon:76066" /chromosome="7" gene 1..2681 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:140069953" CDS 337..2577 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X3" /protein_id="XP_071972367.1" /db_xref="GeneID:140069953" /translation="...
XM_072116266.1 -
Engystomops pustulosus (Tungara frog) -
NCBI
LOCUS XR_012159551 2136 bp RNA linear VRT 19-APR-2025 DEFINITION PREDICTED: Lepidochelys kempii dicer 1, ribonuclease III (DICER1), transcript variant X17, misc_RNA. ACCESSION XR_012159551 VERSION XR_012159551.1 DBLINK BioProject: PRJNA1251686 KEYWORDS RefSeq. SOURCE Lepidochelys kempii (Atlantic ridley) ORGANISM Lepidochelys kempii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Testudinata; Testudines; Cryptodira; Durocryptodira; Americhelydia; Chelonioidea; Cheloniidae; Lepidochelys. COMMENT MODEL REFSEQ: This record is predicted by automated computational...
XR_012159551.1 -
Lepidochelys kempii (Atlantic ridley) -
NCBI
Location/Qualifiers source 1..3475 /organism="Salvelinus alpinus" /mol_type="mRNA" /db_xref="taxon:8036" /chromosome="25" gene 1..3475 /gene="dicer1" /note="dicer 1, ribonuclease type III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 long SRA reads, 3 Proteins" /db_xref="GeneID:139553264" CDS 364..2799 /gene="dicer1" /codon_start=1 /product="endoribonuclease Dicer isoform X5" /protein_id="XP_071221509.1" /db_xref="GeneID:139553264" /translation="...
XM_071365408.1 -
Salvelinus alpinus (Arctic char) -
NCBI
FEATURES Location/Qualifiers source 1..2943 /organism="Salvelinus alpinus" /mol_type="mRNA" /db_xref="taxon:8036" /chromosome="25" gene 1..2943 /gene="dicer1" /note="dicer 1, ribonuclease type III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:139553264" CDS 364..2799 /gene="dicer1" /codon_start=1 /product="endoribonuclease Dicer isoform X5" /protein_id="XP_071221508.1" /db_xref="GeneID:139553264" /translation="...
XM_071365407.1 -
Salvelinus alpinus (Arctic char) -
NCBI
END## FEATURES Location/Qualifiers source 1..3467 /organism="Globicephala melas" /mol_type="mRNA" /db_xref="taxon:9731" /chromosome="2" gene 1..3467 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins" /db_xref="GeneID:115867276" CDS 477..3467 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X3" /protein_id="XP_060151231.1" /db_xref="GeneID:115867276" /translation="...
XM_060295248.1 -
Globicephala melas (long-finned pilot whale) -
NCBI
mol_type="mRNA" /isolate="20LAN1187" /db_xref="taxon:9874" /chromosome="16" /sex="male" /tissue_type="tongue muscle" /ecotype="Illinois" gene 1..2742 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:110140617" CDS 300..2654 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_070333991.1" /db_xref="GeneID:110140617" /translation="...
XM_070477890.1 -
Odocoileus virginianus (white-tailed deer) -
NCBI
LOCUS XR_011706529 1848 bp RNA linear ROD 01-MAR-2025 DEFINITION PREDICTED: Marmota flaviventris dicer 1, ribonuclease III (Dicer1), transcript variant X7, misc_RNA. ACCESSION XR_011706529 VERSION XR_011706529.1 DBLINK BioProject: PRJNA1228026 KEYWORDS RefSeq. SOURCE Marmota flaviventris (yellow-bellied marmot) ORGANISM Marmota flaviventris Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciuromorpha; Sciuridae; Xerinae; Marmotini; Marmota. COMMENT MODEL REFSEQ: This record is predicted by automated computational...
XR_011706529.1 -
Marmota flaviventris (yellow-bellied marmot) -
NCBI
FEATURES Location/Qualifiers source 1..3673 /organism="Engystomops pustulosus" /mol_type="mRNA" /db_xref="taxon:76066" /chromosome="7" gene 1..3673 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:140069953" CDS 337..3582 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_071972366.1" /db_xref="GeneID:140069953" /translation="...
XM_072116265.1 -
Engystomops pustulosus (Tungara frog) -
NCBI
LOCUS XM_071607569 2507 bp mRNA linear ROD 01-MAR-2025 DEFINITION PREDICTED: Marmota flaviventris dicer 1, ribonuclease III (Dicer1), transcript variant X6, mRNA. ACCESSION XM_071607569 VERSION XM_071607569.1 DBLINK BioProject: PRJNA1228026 KEYWORDS RefSeq. SOURCE Marmota flaviventris (yellow-bellied marmot) ORGANISM Marmota flaviventris Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciuromorpha; Sciuridae; Xerinae; Marmotini; Marmota. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis....
XM_071607569.1 -
Marmota flaviventris (yellow-bellied marmot) -
NCBI
LOCUS XR_011517266 3581 bp RNA linear VRT 20-DEC-2024 DEFINITION PREDICTED: Nothobranchius furzeri dicer 1, ribonuclease type III (dicer1), transcript variant X3, misc_RNA. ACCESSION XR_011517266 VERSION XR_011517266.1 DBLINK BioProject: PRJNA1195976 KEYWORDS RefSeq. SOURCE Nothobranchius furzeri (turquoise killifish) ORGANISM Nothobranchius furzeri Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Ovalentaria; Atherinomorphae; Cyprinodontiformes; Nothobranchiidae; Nothobranchius. COMMENT MODEL REFSEQ: This...
XR_011517266.1 -
Nothobranchius furzeri (turquoise killifish) -
NCBI
LOCUS XR_011359458 2409 bp RNA linear VRT 18-NOV-2024 DEFINITION PREDICTED: Dendropsophus ebraccatus dicer 1, ribonuclease III (DICER1), transcript variant X4, misc_RNA. ACCESSION XR_011359458 VERSION XR_011359458.1 DBLINK BioProject: PRJNA1181002 KEYWORDS RefSeq. SOURCE Dendropsophus ebraccatus (hourglass treefrog) ORGANISM Dendropsophus ebraccatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea; Hylidae; Hylinae; Dendropsophini. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record...
XR_011359458.1 -
Dendropsophus ebraccatus (hourglass treefrog) -
NCBI
organism="Bos mutus" /mol_type="mRNA" /isolate="GX-2022" /db_xref="taxon:72004" /chromosome="21" /sex="male" /tissue_type="blood" gene 1..2480 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:102270004" CDS 1101..2480 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X4" /protein_id="XP_070214005.1" /db_xref="GeneID:102270004" /translation="...
XM_070357904.1 -
Bos mutus (wild yak) -
NCBI
Location/Qualifiers source 1..1734 /organism="Heliangelus exortis" /mol_type="mRNA" /db_xref="taxon:472823" /chromosome="5" gene 1..1734 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 ESTs, 3 long SRA reads, 2 Proteins" /db_xref="GeneID:139796986" CDS 355..1734 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_071601785.1" /db_xref="GeneID:139796986" /translation="...
XM_071745684.1 -
Heliangelus exortis -
NCBI
type="blood" /dev_stage="calf" /collected_by="NIAB" /breed="Sahiwal x Tharparkar" /note="offspring of Sahiwal sire and Tharparkar dam" gene 1..1729 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:109575356" CDS 350..1729 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_070631735.1" /db_xref="GeneID:109575356" /translation="...
XM_070775634.1 -
Bos indicus (Bos taurus indicus) -
NCBI
KB3781" /sub_species="gorilla" /db_xref="taxon:9595" /chromosome="15" /sex="male" /tissue_type="Fibroblast" /dev_stage="Mature" gene 1..1722 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 long SRA reads, 4 Proteins" /db_xref="GeneID:101124693" CDS 343..1722 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_063554227.1" /db_xref="GeneID:101124693" /translation="...
XM_063698157.1 -
Gorilla gorilla gorilla (western lowland gorilla) -
NCBI
mol_type="mRNA" /isolate="SW-GA" /db_xref="taxon:9755" /chromosome="11" /sex="female" /tissue_type="muscle" /dev_stage="adult" gene 1..2558 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 7 Proteins" /db_xref="GeneID:102977906" CDS 1179..2558 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X3" /protein_id="XP_054944671.1" /db_xref="GeneID:102977906" /translation="...
XM_055088696.1 -
Physeter macrocephalus (sperm whale) -
NCBI
dev_stage="adult" /geo_loc_name="USA: Ithaca, New York" /collection_date="2018-03-01" /breed="thoroughbred" gene 1..1924 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 63 long SRA reads, 2 Proteins" /db_xref="GeneID:100065648" /db_xref="VGNC:VGNC:17186" CDS 545..1924 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X3" /protein_id="XP_070105894.1" /db_xref="GeneID:100065648" /db_xref="VGNC:VGNC:17186" /translation="...
XM_070249793.1 -
Equus caballus (horse) -
NCBI
chromosome="5" /sex="female" /tissue_type="blood" /dev_stage="adult" /geo_loc_name="USA: Massapequa, NY" /collection_date="2022-08-25" gene 1..1723 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:136102328" CDS 344..1723 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_065695387.1" /db_xref="GeneID:136102328" /translation="...
XM_065839315.2 -
Patagioenas fasciata (band-tailed pigeon) -
NCBI
Apalachee Bay near Panacea, Florida" /lat_lon="30.037222 N 84.170833 W" /collection_date="2020-10-03" /collected_by="Gavin Naylor" gene 1..6202 /gene="dicer1" /note="dicer 1, ribonuclease type III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:138753145" CDS 1834..6120 /gene="dicer1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_069771827.1" /db_xref="GeneID:138753145" /translation="...
XM_069915726.1 -
Narcine bancroftii (Caribbean electric ray) -
NCBI
Poughkeepsie, New York" /lat_lon="41.684639 N 73.895553 W" /collection_date="2018-03-28" /collected_by="Justin Touchon, Erich Jarvis" gene 1..4439 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:138770296" CDS 211..4353 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_069805388.1" /db_xref="GeneID:138770296" /translation="...
XM_069949287.1 -
Dendropsophus ebraccatus (hourglass treefrog) -
NCBI
mRNA" /isolate="rLepKem1" /db_xref="taxon:8472" /chromosome="6" /geo_loc_name="USA: Quincy, Massachusetts" /collection_date="2018-12-12" gene 1..4655 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:140913338" CDS 412..1833 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X5" /protein_id="XP_073205656.1" /db_xref="GeneID:140913338" /translation="...
XM_073349555.1 -
Lepidochelys kempii (Atlantic ridley) -
NCBI
FEATURES Location/Qualifiers source 1..6037 /organism="Salvelinus alpinus" /mol_type="mRNA" /db_xref="taxon:8036" /chromosome="25" gene 1..6037 /gene="dicer1" /note="dicer 1, ribonuclease type III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:139553264" CDS 364..5892 /gene="dicer1" /codon_start=1 /product="endoribonuclease Dicer isoform X4" /protein_id="XP_071221507.1" /db_xref="GeneID:139553264" /translation="...
XM_071365406.1 -
Salvelinus alpinus (Arctic char) -
NCBI
organism="Bos mutus" /mol_type="mRNA" /isolate="GX-2022" /db_xref="taxon:72004" /chromosome="21" /sex="male" /tissue_type="blood" gene 1..10891 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:102270004" CDS 840..6500 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X3" /protein_id="XP_070214004.1" /db_xref="GeneID:102270004" /translation="...
XM_070357903.1 -
Bos mutus (wild yak) -
NCBI
gene="dicer1" /note="dimerization interface [polypeptide binding]; other site" /db_xref="CDD:238333" misc_feature order(5373..5375,5382..5384,5394..5396,5697..5699, 5706..5708) /gene="dicer1" /note="active site" /db_xref="CDD:238333" misc_feature order(5382..5384,5697..5699,5706..5708) /gene="dicer1" /note="metal binding site [ion binding]; metal-binding site" /db_xref="CDD:238333" misc_feature 5820..6008 /gene="dicer1" /note="double-stranded RNA binding motif of endoribonuclease Dicer and similar proteins; Region: DSRM_DICER; cd10843" /db_xref="CDD:380680" misc_feature order...
XM_072364906.1 -
Leuresthes tenuis (California grunion) -
NCBI
organism="Bos mutus" /mol_type="mRNA" /isolate="GX-2022" /db_xref="taxon:72004" /chromosome="21" /sex="male" /tissue_type="blood" gene 1..11051 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:102270004" CDS 982..6660 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_070214003.1" /db_xref="GeneID:102270004" /translation="...
XM_070357902.1 -
Bos mutus (wild yak) -
NCBI
organism="Bos mutus" /mol_type="mRNA" /isolate="GX-2022" /db_xref="taxon:72004" /chromosome="21" /sex="male" /tissue_type="blood" gene 1..11056 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:102270004" CDS 987..6665 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_070214002.1" /db_xref="GeneID:102270004" /translation="...
XM_070357901.1 -
Bos mutus (wild yak) -
NCBI
FEATURES Location/Qualifiers source 1..8012 /organism="Engystomops pustulosus" /mol_type="mRNA" /db_xref="taxon:76066" /chromosome="7" gene 1..8012 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 25 Proteins" /db_xref="GeneID:140069953" CDS 337..5925 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_071972365.1" /db_xref="GeneID:140069953" /translation="...
XM_072116264.1 -
Engystomops pustulosus (Tungara frog) -
NCBI
gene="dicer1" /note="dimerization interface [polypeptide binding]; other site" /db_xref="CDD:238333" misc_feature order(5062..5064,5071..5073,5083..5085,5386..5388, 5395..5397) /gene="dicer1" /note="active site" /db_xref="CDD:238333" misc_feature order(5071..5073,5386..5388,5395..5397) /gene="dicer1" /note="metal binding site [ion binding]; metal-binding site" /db_xref="CDD:238333" misc_feature 5509..5697 /gene="dicer1" /note="double-stranded RNA binding motif of endoribonuclease Dicer and similar proteins; Region: DSRM_DICER; cd10843" /db_xref="CDD:380680" misc_feature order...
XM_071917393.1 -
Centroberyx gerrardi (bight redfish) -
NCBI
organism="Bos mutus" /mol_type="mRNA" /isolate="GX-2022" /db_xref="taxon:72004" /chromosome="21" /sex="male" /tissue_type="blood" gene 1..11144 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:102270004" CDS 985..6753 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_070214001.1" /db_xref="GeneID:102270004" /translation="...
XM_070357900.1 -
Bos mutus (wild yak) -
NCBI
organism="Bos mutus" /mol_type="mRNA" /isolate="GX-2022" /db_xref="taxon:72004" /chromosome="21" /sex="male" /tissue_type="blood" gene 1..11080 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:102270004" CDS 921..6689 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_070214000.1" /db_xref="GeneID:102270004" /translation="...
XM_070357899.1 -
Bos mutus (wild yak) -
NCBI
organism="Bos mutus" /mol_type="mRNA" /isolate="GX-2022" /db_xref="taxon:72004" /chromosome="21" /sex="male" /tissue_type="blood" gene 1..11273 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:102270004" CDS 1114..6882 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_070213999.1" /db_xref="GeneID:102270004" /translation="...
XM_070357898.1 -
Bos mutus (wild yak) -
NCBI
organism="Bos mutus" /mol_type="mRNA" /isolate="GX-2022" /db_xref="taxon:72004" /chromosome="21" /sex="male" /tissue_type="blood" gene 1..11245 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:102270004" CDS 1086..6854 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X1" /protein_id="XP_070213998.1" /db_xref="GeneID:102270004" /translation="...
XM_070357897.1 -
Bos mutus (wild yak) -
NCBI
tissue_type="Whole blood in anticoagulant" /geo_loc_name="USA: Ithaca, New York" /collection_date="2018-03-01" /breed="Donkey" gene 1..9369 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 148 long SRA reads, 1 Protein" /db_xref="GeneID:106832636" CDS 90..5042 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X4" /protein_id="XP_070370357.1" /db_xref="GeneID:106832636" /translation="...
XM_070514256.1 -
Equus asinus (donkey) -
NCBI
type="Whole blood in anticoagulant" /geo_loc_name="USA: Ithaca, New York" /collection_date="2018-03-01" /breed="Donkey" gene 1..10231 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 155 long SRA reads, 2 Proteins" /db_xref="GeneID:106832636" CDS 229..5904 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X3" /protein_id="XP_070370356.1" /db_xref="GeneID:106832636" /translation="...
XM_070514255.1 -
Equus asinus (donkey) -
NCBI
type="Whole blood in anticoagulant" /geo_loc_name="USA: Ithaca, New York" /collection_date="2018-03-01" /breed="Donkey" gene 1..10236 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 155 long SRA reads, 2 Proteins" /db_xref="GeneID:106832636" CDS 234..5909 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X3" /protein_id="XP_070370355.1" /db_xref="GeneID:106832636" /translation="...
XM_070514254.1 -
Equus asinus (donkey) -
NCBI
Data Export:
下記より最大10000件まで検索結果を取得できます。
Debug Info:
Redirect URI : https://ggrna.dbcls.jp/ja/Dicer
lang : ja |
div : |
spe : |
query_string : Dicer |
format : html |
download :
0.000 | 0.000 | search_start;
0.315 | 0.315 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Dicer)%7C(nt:Dicer)%7C(aa:Dicer))?to=0&format=json
2.080 | 1.765 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Dicer)%7C(nt:Dicer)%7C(aa:Dicer))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
2.086 | 0.007 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]